TADB
TA ID3644
Type2
RepliconNC_009230 [Browse all TAs(s) in this replicon]
StrainBurkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence.
Location102632..103527
Classification (toxin-antitoxin)-/COG5642-COG5654
ToxinBcep1808_6714 (175 a.a. | 102632..103159 | GeneID: 4948038)
AntitoxinBcep1808_6715 (123 a.a. | 103156..103527 | GeneID: 4948039)
Toxin:
Protein Sequence: 175 a.a.
>gi|134288242|ref|YP_001110405.1| hypothetical protein Bcep1808_6714 [Burkholderia vietnamiensis G4] [Bcep1808_6714]
MILTHLPAGTMLYRAHAPRWASRPASGAGAAAKGGRFNREGIEALYLSLEELTALREYQQTSPFLPPCTV
CSYTVALRNLVDLRQLHRGPLWDDLWHDWREDWRHLKFELHIEPPTWVLSDMVREQGFTGIVFPSQTHES
GTNLVVFADRLGDGNSIEVNDPDGQLPRDQASWPR
 
Nucleotide Sequence: 528 bp
>gi|134288152|ref|NC_009230.1|:c103159-102632 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence [Bcep1808_6714]
ATGATCCTGACGCACCTGCCGGCGGGCACTATGCTTTACCGCGCACATGCACCCCGCTGGGCCAGCCGGC
CGGCCAGCGGAGCCGGCGCCGCAGCCAAGGGCGGGCGCTTCAACCGCGAAGGTATCGAGGCACTATACTT
GTCGCTGGAAGAACTGACAGCGCTGCGCGAGTACCAGCAGACCTCGCCCTTCCTGCCACCCTGCACGGTC
TGCTCCTACACCGTCGCGCTGCGTAATCTGGTCGACCTGCGGCAACTCCACCGCGGCCCTCTTTGGGACG
ACCTTTGGCACGACTGGCGCGAGGATTGGCGGCACCTGAAATTCGAGCTGCACATCGAGCCCCCGACCTG
GGTTCTCAGCGACATGGTTCGGGAGCAGGGCTTTACCGGCATTGTGTTTCCCAGCCAAACCCACGAGAGC
GGTACAAACCTCGTGGTGTTTGCCGACCGCCTCGGCGATGGCAATTCGATCGAGGTCAACGACCCGGATG
GCCAACTTCCGCGGGACCAGGCAAGTTGGCCGCGTTGA
 Primer design

Antitoxin:
Protein Sequence: 123 a.a.
>gi|134288243|ref|YP_001110406.1| hypothetical protein Bcep1808_6715 [Burkholderia vietnamiensis G4] [Bcep1808_6715]
MSAIAFADVLESAREAGTSRLSAANLANVLGLQQQDLATMAGVHRNTLRTHPESPKLQSTLRDLMRVLSA
AAAVQPDFERALFLVKNQPIPAFRHKTILQLLQDGRTEDAIDYLESISAGFVG
 
Nucleotide Sequence: 372 bp
>gi|134288152|ref|NC_009230.1|:c103527-103156 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence [Bcep1808_6715]
ATGAGCGCCATTGCCTTTGCCGACGTGCTTGAGTCCGCGCGTGAAGCGGGAACGTCCCGTCTATCCGCCG
CGAACCTCGCCAACGTCTTGGGCTTGCAGCAGCAAGACCTAGCAACCATGGCGGGTGTTCATCGCAACAC
GCTGCGCACCCATCCTGAGTCGCCAAAACTCCAGTCCACCTTGCGCGACCTCATGCGCGTGCTGTCAGCA
GCTGCGGCGGTACAGCCGGACTTCGAGCGAGCGCTGTTTCTGGTCAAGAACCAGCCCATCCCCGCGTTTC
GCCATAAGACTATCCTGCAACTGCTCCAGGACGGGCGGACTGAGGATGCGATCGACTATCTGGAGTCGAT
CAGCGCAGGATTTGTTGGATGA
 Primer design


The information of TA components from NC_009230
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Bcep1808_671197924..100668 [-], 2745134288239restriction endonuclease  -
2Bcep1808_6712100810..101253 [-], 444134288240hypothetical protein  -
3Bcep1808_6713101711..102196 [+], 486134288241hypothetical protein  -
4Bcep1808_6714102632..103159 [-], 528134288242hypothetical protein  Toxin
5Bcep1808_6715103156..103527 [-], 372134288243hypothetical protein  Antitoxin
6Bcep1808_6716103773..104087 [-], 315134288244hypothetical protein  -
7Bcep1808_6717104211..104495 [-], 285134288245hypothetical protein  -
8Bcep1808_6718104670..105311 [-], 642134288246HAD family hydrolase  -
9Bcep1808_6719105385..106002 [-], 618134288247hypothetical protein  -
10Bcep1808_6720105974..106213 [-], 240134288248hypothetical protein  -
N/A