TADB
TA ID4648
Type2
RepliconNC_009937 [Browse all TAs(s) in this replicon]
StrainAzorhizobium caulinodans ORS 571 chromosome, complete genome.
Location596971..597506
Classification (toxin-antitoxin)-/PHD-RelE
ToxinAZC_0539 (88 a.a. | 597240..597506 | GeneID: 5688346)
AntitoxinAZC_0538 (90 a.a. | 596971..597243 | GeneID: 5688345)
Toxin:
Protein Sequence: 88 a.a.
>gi|158422163|ref|YP_001523455.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_0539]
MKLVFATRAWEDYLHWVDADRNVLERLNALIEECRRTPFSGTGRPEPLKGDLSGWWSRRITLQDRLVYRV
AGKPPHQSLEIAQCRYHY
 
Nucleotide Sequence: 267 bp
>gi|158421624|ref|NC_009937.1|:597240-597506 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_0539]
GTGAAGCTGGTGTTCGCCACCCGCGCCTGGGAGGATTATCTCCATTGGGTGGATGCGGACCGCAACGTGC
TGGAGCGGCTGAACGCCTTGATCGAGGAATGCCGCCGCACGCCCTTTTCCGGCACCGGCCGGCCCGAGCC
GCTGAAGGGCGACCTCTCTGGCTGGTGGTCGCGGCGCATCACCTTGCAGGACCGTCTCGTCTATCGGGTC
GCGGGCAAGCCGCCGCACCAGAGCCTGGAGATCGCCCAGTGCCGCTATCATTACTGA
 Primer design

Antitoxin:
Protein Sequence: 90 a.a.
>gi|158422162|ref|YP_001523454.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_0538]
MIRPRAMDVLSYSDTRANLKEVMDRVVEDHAPVVITRQKAEAVVMVSLSDWSAMEETLHLLSSPANAARL
REGVAELEAGGGSERDLVVP
 
Nucleotide Sequence: 273 bp
>gi|158421624|ref|NC_009937.1|:596971-597243 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_0538]
ATGATCCGACCCCGTGCCATGGACGTGCTGAGCTATTCCGACACCCGCGCCAACCTCAAAGAGGTGATGG
ACCGGGTGGTGGAGGACCATGCGCCGGTAGTCATCACCCGCCAGAAGGCGGAGGCGGTGGTGATGGTCTC
CTTGAGTGACTGGAGCGCCATGGAGGAGACGCTGCATCTGCTCTCCTCCCCCGCCAATGCGGCGCGGCTG
CGCGAAGGCGTGGCCGAGCTTGAGGCCGGTGGCGGCAGCGAACGCGACCTTGTGGTGCCGTGA
 Primer design


The information of TA components from NC_009937
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1AZC_0534592160..592858 [+], 699158422158hypothetical protein  -
2AZC_0535592879..594441 [+], 1563158422159amidophosphoribosyltransferase  -
3AZC_0536594545..595288 [+], 744158422160NAD/NADP dependent oxidoreductase  -
4AZC_0537595380..596897 [+], 1518158422161leucyl aminopeptidase  -
5AZC_0538596971..597243 [+], 273158422162hypothetical protein  Antitoxin
6AZC_0539597240..597506 [+], 267158422163addiction module toxin  Toxin
7AZC_0540597538..597987 [+], 450158422164DNA polymerase III subunit chi  -
8AZC_0541598209..598673 [-], 465158422165hypothetical protein  -
9AZC_0542598725..599174 [-], 450158422166hypothetical protein  -
10AZC_0543599431..600048 [+], 6181584221672-hydroxychromene-2-carboxylate isomerase  -
11AZC_0544600085..600570 [+], 486158422168hypothetical protein  -
12AZC_0545600571..602040 [-], 1470158422169esterase  -
N/A