TADB
TA ID4652
Type2
RepliconNC_009937 [Browse all TAs(s) in this replicon]
StrainAzorhizobium caulinodans ORS 571 chromosome, complete genome.
Location4178670..4179273
Classification (toxin-antitoxin)-/RHH-COG2929
ToxinAZC_3641 (95 a.a. | 4178986..4179273 | GeneID: 5691395)
AntitoxinAZC_3640 (89 a.a. | 4178670..4178939 | GeneID: 5691394)
Toxin:
Protein Sequence: 95 a.a.
>gi|158425265|ref|YP_001526557.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_3641]
MPMPELCFEWDATKNETNIAKHRISFPTVARAMVEKPYLSLRSDRGGEERHVSIIEIQGKLFAVIHVQRG
EAIRIISARRARKDEEQQYRALFAR
 
Nucleotide Sequence: 288 bp
>gi|158421624|ref|NC_009937.1|:c4179273-4178986 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_3641]
TTGCCCATGCCCGAGCTCTGTTTCGAGTGGGACGCGACAAAGAACGAAACCAACATTGCCAAGCACCGCA
TTTCATTCCCGACCGTCGCACGGGCGATGGTCGAGAAGCCCTATCTGAGCCTGCGCTCCGACCGGGGAGG
CGAAGAAAGACATGTCAGCATCATCGAAATCCAAGGCAAGCTCTTCGCCGTCATCCATGTCCAGCGGGGT
GAAGCGATCCGCATCATCTCCGCCCGCCGCGCCCGAAAGGACGAAGAGCAGCAATATCGTGCGCTATTCG
CCCGATGA
 Primer design

Antitoxin:
Protein Sequence: 89 a.a.
>gi|158425264|ref|YP_001526556.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_3640]
MSEAEIETAAHADPAWEGLLDLDWSQAEVVVPPKKIPISIRIDEDVLAFFKAGGEGYQKRINAVLRSFVQ
QSDRAPRMAASRGKRAAKT
 
Nucleotide Sequence: 270 bp
>gi|158421624|ref|NC_009937.1|:c4178939-4178670 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_3640]
ATGAGCGAGGCCGAGATCGAAACGGCCGCGCACGCCGACCCCGCTTGGGAAGGTCTGCTCGACCTCGACT
GGTCGCAGGCCGAAGTGGTCGTGCCGCCGAAGAAAATCCCCATCTCCATCCGGATTGACGAGGATGTGCT
GGCCTTCTTCAAAGCCGGAGGCGAGGGCTACCAGAAGCGCATCAATGCCGTTCTGCGCTCGTTCGTGCAG
CAGTCGGATCGCGCGCCCCGAATGGCCGCTTCCCGCGGCAAGAGGGCGGCCAAGACCTAG
 Primer design


The information of TA components from NC_009937
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1AZC_36354173737..4174966 [-], 1230158425259formyl-coenzyme A transferase  -
2AZC_36364175167..4175637 [-], 471158425260hypothetical protein  -
3gntR4175985..4176674 [+], 690158425261regulatory protein  -
4AZC_36384176776..4177981 [-], 1206158425262carbamoyl phosphate synthase small subunit  -
5AZC_36394178163..4178621 [+], 459158425263GatB protein  -
6AZC_36404178670..4178939 [-], 270158425264hypothetical protein  Antitoxin
7AZC_36414178986..4179273 [-], 288158425265hypothetical protein  Toxin
8dnaG4179404..4181335 [+], 1932158425266DNA primase  -
9AZC_36434181439..4183511 [+], 2073158425267RNA polymerase sigma factor RpoD  -
N/A