TADB
TA ID4656
Type2
RepliconNC_009937 [Browse all TAs(s) in this replicon]
StrainAzorhizobium caulinodans ORS 571 chromosome, complete genome.
Location4821527..4822119
Classification (toxin-antitoxin)-/HicB-HicA
ToxinAZC_4230 (84 a.a. | 4821527..4821781 | GeneID: 5688736)
AntitoxinAZC_4231 (112 a.a. | 4821781..4822119 | GeneID: 5688737)
Toxin:
Protein Sequence: 84 a.a.
>gi|158425854|ref|YP_001527146.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4230]
MKKRHLATLELIFSHPVSGSVRWSDVVALFQALGAEVSEREGSRVGVVLFGEVRVFHRPHPSPNTDKGAV
ASIRKWLDEHGVRP
 
Nucleotide Sequence: 255 bp
>gi|158421624|ref|NC_009937.1|:4821527-4821781 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4230]
GTGAAGAAGCGCCACCTGGCCACGCTTGAGCTGATCTTTTCGCATCCGGTGAGCGGCTCCGTCCGCTGGT
CGGATGTCGTGGCTCTGTTTCAAGCGCTGGGCGCCGAGGTGAGCGAGCGGGAAGGGTCGCGTGTGGGCGT
GGTGCTGTTCGGCGAAGTGCGGGTGTTTCACCGTCCACACCCTTCGCCCAACACGGACAAGGGCGCCGTC
GCCAGCATTCGCAAGTGGCTCGACGAACACGGAGTTCGGCCATGA
 Primer design

Antitoxin:
Protein Sequence: 112 a.a.
>gi|158425855|ref|YP_001527147.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4231]
MNIIEIDGEKAVVAFDPDIRMFRGEFVGLNGGADFYAETVEQLYEEGRTSLAAFLALCAEKGIAPRRTFS
GRFNVRLDPADHEAAVVAASAQGKSLNEWVAAAIRDAADNAA
 
Nucleotide Sequence: 339 bp
>gi|158421624|ref|NC_009937.1|:4821781-4822119 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4231]
ATGAACATCATCGAGATCGACGGCGAAAAGGCCGTGGTGGCCTTCGATCCGGACATCCGGATGTTCCGGG
GGGAGTTCGTCGGGTTGAACGGTGGGGCCGATTTCTACGCCGAGACCGTTGAGCAGTTGTACGAGGAGGG
GCGCACGTCGCTCGCCGCTTTCCTCGCGCTCTGTGCCGAGAAGGGGATCGCGCCACGGCGTACCTTCTCG
GGCCGCTTCAACGTGCGGCTGGACCCTGCCGACCATGAGGCCGCCGTGGTGGCCGCCTCCGCTCAGGGAA
AGAGCCTGAATGAGTGGGTTGCCGCCGCGATTCGTGACGCGGCGGACAATGCAGCCTGA
 Primer design


The information of TA components from NC_009937
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1amtB4817135..4818616 [-], 1482158425850ammonium transporter  -
2glnK4818647..4818985 [-], 339158425851GlnK protein  -
3AZC_42284819248..4820180 [-], 933158425852acyl-CoA thioesterase  -
4AZC_42294820243..4821478 [+], 12361584258532-octaprenyl-6-methoxyphenyl hydroxylase  -
5AZC_42304821527..4821781 [+], 255158425854HicA-like protein  Toxin
6AZC_42314821781..4822119 [+], 339158425855hypothetical protein  Antitoxin
7AZC_42324822159..4822485 [-], 327158425856hypothetical protein  -
8AZC_42334822573..4823472 [+], 900158425857transmembrane protein  -
9hisS4823515..4825023 [-], 1509158425858histidyl-tRNA synthetase  -
10AZC_42354825080..4825934 [-], 855158425859hypothetical protein  -
11AZC_42364825976..4826482 [+], 507158425860phenylacetic acid degradation-related protein  -
N/A