TADB
TA ID4658
Type2
RepliconNC_009937 [Browse all TAs(s) in this replicon]
StrainAzorhizobium caulinodans ORS 571 chromosome, complete genome.
Location5186951..5187557
Classification (toxin-antitoxin)-/RHH-RelE
ToxinAZC_4558 (106 a.a. | 5187237..5187557 | GeneID: 5691381)
AntitoxinAZC_4557 (100 a.a. | 5186951..5187253 | GeneID: 5691380)
Toxin:
Protein Sequence: 106 a.a.
>gi|158426182|ref|YP_001527474.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4558]
MGVSLKVTFRPRAAEDLERLYIFIRDAADAGPDIAIRFVLSIQEQCARLADMPERAPLRPEVGEDVRVLS
MKRRISIAYRVRRTEVEILGIFYRGQVLDLDPPGEK
 
Nucleotide Sequence: 321 bp
>gi|158421624|ref|NC_009937.1|:5187237-5187557 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4558]
ATGGGCGTGAGCCTTAAGGTCACGTTCAGGCCAAGAGCCGCCGAAGACTTGGAGCGGCTCTATATCTTCA
TTCGGGACGCGGCGGACGCCGGCCCGGACATCGCCATCCGCTTCGTTCTCAGCATTCAGGAGCAATGTGC
GCGTCTGGCAGACATGCCGGAACGCGCGCCCCTGCGCCCGGAGGTCGGGGAGGACGTCCGGGTTCTGAGC
ATGAAGCGGCGCATCTCCATCGCCTATCGTGTGCGCCGGACGGAGGTGGAGATTCTCGGCATCTTCTACC
GAGGCCAAGTGCTGGATCTGGATCCGCCAGGCGAGAAATAG
 Primer design

Antitoxin:
Protein Sequence: 100 a.a.
>gi|158426181|ref|YP_001527473.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4557]
MIGPERGYPMRSSKPITVTLGDMAPRVEALRRAGHYASTSEVLRAGVRALEREQEALDAYMREHVRQALE
DPRPSVDADEVFDRLKALHQRSEKADGREP
 
Nucleotide Sequence: 303 bp
>gi|158421624|ref|NC_009937.1|:5186951-5187253 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4557]
ATGATTGGTCCCGAAAGGGGATATCCCATGCGGAGCAGCAAGCCGATCACGGTCACGCTCGGCGATATGG
CGCCCCGGGTGGAAGCCCTGCGCCGCGCCGGACATTATGCCTCGACCAGTGAAGTGCTGCGCGCGGGCGT
CCGCGCTCTCGAGCGCGAGCAGGAGGCGCTCGACGCTTATATGCGGGAGCACGTCCGCCAAGCCCTCGAA
GACCCCCGTCCCAGTGTTGATGCGGACGAGGTGTTCGATCGGCTGAAAGCGCTTCACCAGAGGTCCGAGA
AGGCCGATGGGCGTGAGCCTTAA
 Primer design


The information of TA components from NC_009937
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1AZC_45545183122..5184348 [+], 1227158426178cell division protein  -
2murG5184345..5185448 [+], 1104158426179undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase  -
3murC5185507..5186910 [+], 1404158426180UDP-N-acetylmuramate--L-alanine ligase  -
4AZC_45575186951..5187253 [+], 303158426181hypothetical protein  Antitoxin
5AZC_45585187237..5187557 [+], 321158426182hypothetical protein  Toxin
6AZC_45595187707..5188594 [+], 888158426183cation efflux protein  -
7murB5188662..5189588 [+], 927158426184UDP-N-acetylenolpyruvoylglucosamine reductase  -
8ddl5189748..5190668 [+], 921158426185D-alanine--D-alanine ligase  -
9ftsQ5190683..5191669 [+], 987158426186cell division protein  -
N/A