TADB
TA ID4659
Type2
RepliconNC_009937 [Browse all TAs(s) in this replicon]
StrainAzorhizobium caulinodans ORS 571 chromosome, complete genome.
Location5283775..5284376
Classification (toxin-antitoxin)-/Xre-RelE
ToxinAZC_4646 (94 a.a. | 5283775..5284059 | GeneID: 5692253)
AntitoxinAZC_4647 (101 a.a. | 5284071..5284376 | GeneID: 5690040)
Toxin:
Protein Sequence: 94 a.a.
>gi|158426270|ref|YP_001527562.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4646]
MIRSFRDRRAEAIFAGRHPGKGFPADLVRPAARKLAMLDAAAVLEDLRAPPANRLEELKGDRAGQHSIRV
NDQFRICFVWVDGGVEQVEITDYH
 
Nucleotide Sequence: 285 bp
>gi|158421624|ref|NC_009937.1|:5283775-5284059 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4646]
ATGATCCGGAGCTTCCGGGACCGCAGAGCCGAAGCGATCTTTGCGGGCCGCCATCCCGGCAAGGGATTTC
CGGCCGATCTGGTCCGACCCGCTGCCCGCAAGCTGGCGATGCTCGACGCGGCAGCGGTGTTGGAGGATTT
GCGAGCCCCGCCAGCGAACCGGCTGGAAGAGCTGAAGGGCGATCGGGCGGGCCAGCATTCCATTCGCGTG
AACGACCAGTTCCGCATCTGCTTCGTCTGGGTGGACGGCGGCGTGGAACAGGTGGAGATCACCGATTACC
ACTGA
 Primer design

Antitoxin:
Protein Sequence: 101 a.a.
>gi|158426271|ref|YP_001527563.1| unnamed protein product [Azorhizobium caulinodans ORS 571] [AZC_4647]
MPADEQKPLAPVHPGEILREEFLQPLGLTPYALGGALRVPRTRIERLVRGETSLTADTALRLARYFGTTP
DFWLRLQTAHDLRVEERRIAAELERIAPRAA
 
Nucleotide Sequence: 306 bp
>gi|158421624|ref|NC_009937.1|:5284071-5284376 Azorhizobium caulinodans ORS 571 chromosome, complete genome [AZC_4647]
ATGCCTGCCGATGAACAGAAACCCCTCGCGCCCGTGCATCCGGGCGAAATCCTGCGGGAAGAGTTCCTCC
AGCCGCTCGGCCTGACCCCCTACGCACTCGGGGGGGCACTCCGTGTGCCGCGCACGCGGATCGAGCGGCT
CGTGCGCGGGGAAACCTCCCTCACGGCGGACACCGCCCTGCGTCTTGCGCGCTATTTCGGCACCACGCCG
GACTTCTGGCTGCGCCTTCAGACGGCGCACGATCTGCGCGTGGAGGAACGGCGGATCGCTGCCGAACTCG
AACGCATCGCGCCGCGCGCCGCCTGA
 Primer design


The information of TA components from NC_009937
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1AZC_46415279364..5279840 [-], 477158426265large-conductance mechanosensitive channel  -
2fabA5280065..5280610 [+], 5461584262663-hydroxydecanoyl-ACP dehydratase  -
3AZC_46435280838..5282055 [+], 12181584262673-oxoacyl-ACP synthase  -
4AZC_46445282170..5283027 [+], 858158426268enoyl-ACP reductase  -
5AZC_46455283099..5283578 [-], 480158426269transcription elongation factor regulatory protein  -
6AZC_46465283775..5284059 [+], 285158426270plasmid maintenance system killer protein  Toxin
7AZC_46475284071..5284376 [+], 306158426271plasmid maintenance system antidote protein  Antitoxin
8AZC_46485284385..5286079 [-], 1695158426272isobutyryl-CoA dehydrogenase  -
9AZC_46495286191..5287366 [-], 1176158426273hypothetical protein  -
10AZC_46505287396..5288370 [+], 975158426274ribonuclease BN  -
11AZC_46515288367..5288846 [+], 480158426275hypothetical protein  -
N/A