TADB
TA ID4730
Type2
RepliconNC_009957 [Browse all TAs(s) in this replicon]
StrainDinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence.
Location79361..80202
Classification (toxin-antitoxin)-/AbrB-RelE
ToxinDshi_4011 (172 a.a. | 79361..79879 | GeneID: 5714540)
AntitoxinDshi_4012 (108 a.a. | 79876..80202 | GeneID: 5714541)
Toxin:
Protein Sequence: 172 a.a.
>gi|159046549|ref|YP_001542219.1| hypothetical protein Dshi_4011 [Dinoroseobacter shibae DFL 12] [Dshi_4011]
MSGDSVPAQAPLVVNGWSIYAHPLFLDQLEGLIEEVEARKARDPKTWRKKNPTKRLAAIFKLVTEAIPVD
PGAAAFRQGGTLGDHRKHWFRAKFFQQYRLFYRFNSDAKVIVVAWVNDDKTLRAYGSKTDAYATFKGMLE
DGNPPDNFDALLKEAAAANKRFETSLEAAPDR
 
Nucleotide Sequence: 519 bp
>gi|159046469|ref|NC_009957.1|:c79879-79361 Dinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence [Dshi_4011]
ATGAGCGGCGATAGCGTGCCCGCCCAAGCGCCCCTTGTCGTAAACGGATGGTCGATTTATGCGCATCCGC
TCTTTCTGGATCAGCTCGAAGGGCTGATTGAAGAGGTCGAGGCGCGTAAGGCACGCGATCCTAAGACCTG
GCGCAAGAAAAACCCGACGAAACGGCTGGCCGCCATCTTCAAGCTGGTCACCGAGGCCATACCGGTAGAT
CCGGGTGCCGCCGCCTTTCGGCAAGGCGGCACACTCGGCGATCACCGCAAGCACTGGTTCCGTGCGAAAT
TCTTCCAGCAGTATCGGCTGTTCTATCGGTTCAACAGCGATGCGAAGGTCATCGTGGTGGCCTGGGTGAA
CGACGACAAGACCCTGCGCGCCTACGGCAGCAAGACGGATGCCTATGCGACGTTCAAAGGGATGTTGGAA
GATGGCAATCCACCTGACAATTTTGACGCGCTCTTGAAAGAAGCAGCGGCGGCGAACAAGCGGTTCGAGA
CGTCCCTTGAAGCGGCGCCCGATCGGTAA
 Primer design

Antitoxin:
Protein Sequence: 108 a.a.
>gi|159046550|ref|YP_001542220.1| putative regulator PrlF [Dinoroseobacter shibae DFL 12] [Dshi_4012]
MTALAQDVSKLTDRYQTTVPAGVRKQLKLGKGDQIRYCTEPSGRVYIEPVRSDEEDPVLGAFLDFVEADI
KAHPDRIRAFDGALHDRLAALVGDVDVDLDAPLSLEDE
 
Nucleotide Sequence: 327 bp
>gi|159046469|ref|NC_009957.1|:c80202-79876 Dinoroseobacter shibae DFL 12 plasmid pDSHI03, complete sequence [Dshi_4012]
ATGACAGCCCTCGCACAAGATGTCTCGAAGCTCACGGATCGGTATCAGACGACCGTGCCGGCGGGTGTGC
GCAAGCAGCTCAAGCTGGGCAAGGGCGACCAGATTCGTTACTGCACCGAGCCGAGTGGCAGGGTCTATAT
CGAGCCCGTGCGCAGCGACGAGGAAGATCCCGTGCTAGGAGCCTTTCTCGATTTTGTCGAGGCCGATATC
AAGGCGCATCCGGACCGCATTCGGGCGTTCGATGGGGCTTTGCATGACCGTCTTGCAGCACTGGTCGGAG
ACGTTGACGTCGATCTCGATGCGCCGCTATCGCTCGAGGATGAATGA
 Primer design


The information of TA components from NC_009957
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Dshi_400977303..78163 [-], 861159046547LysR family transcriptional regulator  -
2Dshi_401078320..79039 [+], 720159046548hypothetical protein  -
3Dshi_401179361..79879 [-], 519159046549hypothetical protein  Toxin
4Dshi_401279876..80202 [-], 327159046550putative regulator PrlF  Antitoxin
5Dshi_401380329..80982 [-], 654159046551hypothetical protein  -
6Dshi_401480982..81674 [-], 693159046552hypothetical protein  -
7Dshi_401581749..83731 [-], 1983159046553parB-like partition protein  -
8Dshi_401683888..84277 [-], 390159046554hypothetical protein  -
9Dshi_401784365..84574 [-], 210159046555hypothetical protein  -
N/A