TADB
TA ID5652
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location64936..65858
Classification (toxin-antitoxin)-/HEPN-MNT
ToxinCphamn1_0069 (108 a.a. | 65532..65858 | GeneID: 6373712)
AntitoxinCphamn1_0068 (199 a.a. | 64936..65535 | GeneID: 6373711)
Toxin:
Protein Sequence: 108 a.a.
>gi|189499063|ref|YP_001958533.1| DNA polymerase beta domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_0069]
MKYGLKNSTIAKIRSVLARYRQVEKAILYGSRAKGNYTTGSDIDLTLLGGHDLDLKVLYRIMDEIDDLLL
PYTIDISLLHTIKDQDVLDHIKRFGTVFYEKTPESHVA
 
Nucleotide Sequence: 327 bp
>gi|189499000|ref|NC_010831.1|:65532-65858 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0069]
ATGAAATACGGACTCAAAAATTCTACCATAGCAAAGATTCGTAGCGTGCTGGCGCGCTACAGGCAGGTGG
AGAAAGCCATTCTCTACGGTTCCCGGGCCAAAGGGAATTATACAACCGGTTCGGATATAGATCTGACGCT
GCTTGGCGGCCATGATCTGGACCTGAAAGTACTTTACCGTATCATGGATGAAATCGACGACCTGCTCTTG
CCCTACACCATCGATATTTCCCTCCTGCATACCATTAAAGATCAGGATGTACTCGATCACATTAAACGTT
TCGGCACGGTGTTTTACGAAAAAACACCAGAAAGCCATGTTGCCTGA
 Primer design

Antitoxin:
Protein Sequence: 199 a.a.
>gi|189499062|ref|YP_001958532.1| nucleotidyltransferase substrate binding protein [Chlorobium phaeobacteroides BS1] [Cphamn1_0068]
MAEDPFQLEKSEQACALLLSLILVSDFVVQIASLKFNLYHFRNTVFGQFFLAKIRRYSMNSQDIRWVQRY
KHLIQAYDQLDRAVDLAQQRSLSELEEQGLIQSFEYTHELAWNTLKDFLANKGVQPLYGSKDTTRAAFKH
RLIEDGNIWMEMIKSRYLTSHTYNREIAEEIALAIRQHYHAAFRKLLETLEPLSREKPE
 
Nucleotide Sequence: 600 bp
>gi|189499000|ref|NC_010831.1|:64936-65535 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0068]
ATGGCTGAAGATCCATTTCAATTGGAAAAGAGCGAGCAAGCCTGTGCACTATTGCTGTCACTGATCCTGG
TATCAGACTTTGTGGTACAGATTGCATCTTTAAAATTCAATCTGTACCATTTTCGTAATACGGTATTCGG
TCAGTTTTTCCTGGCCAAGATAAGGAGATACTCTATGAACAGTCAGGATATTCGATGGGTTCAGCGGTAC
AAGCATTTGATTCAGGCGTATGATCAGCTTGACCGTGCCGTCGATCTTGCGCAACAGCGCTCCTTGAGTG
AGCTGGAGGAACAGGGCCTGATCCAGTCTTTTGAATACACCCATGAACTGGCATGGAACACCCTGAAGGA
TTTTCTCGCAAACAAGGGTGTTCAACCGCTGTACGGATCAAAAGACACGACCCGAGCGGCGTTCAAGCAC
AGATTGATTGAAGACGGAAATATCTGGATGGAGATGATCAAAAGCCGGTATCTGACATCGCATACCTATA
ATCGGGAAATTGCGGAAGAAATAGCTCTGGCAATCCGTCAGCACTATCATGCAGCCTTCCGGAAGCTTCT
GGAAACACTTGAACCGCTCAGCAGAGAGAAGCCGGAATGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_006259989..60303 [+], 315189499060hypothetical protein  -
2Cphamn1_006461934..63109 [-], 1176189499061ATPase (AAA+ superfamily)-like protein  -
3Cphamn1_006864936..65535 [+], 600189499062nucleotidyltransferase substrate binding protein  Antitoxin
4Cphamn1_006965532..65858 [+], 327189499063DNA polymerase beta domain-containing protein  Toxin
5Cphamn1_007065972..66376 [-], 405189499064hypothetical protein  -
6Cphamn1_007166567..67145 [+], 579189499065ErfK/YbiS/YcfS/YnhG family protein  -
7Cphamn1_007267205..69229 [-], 2025189499066ATP-dependent DNA helicase RecQ  -
8Cphamn1_007369330..70388 [+], 1059189499067radical SAM protein  -
N/A