TADB
TA ID5656
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location590604..591234
Classification (toxin-antitoxin)-/Xre-RelE
ToxinCphamn1_0556 (88 a.a. | 590604..590870 | GeneID: 6374220)
AntitoxinCphamn1_0557 (89 a.a. | 590965..591234 | GeneID: 6374221)
Toxin:
Protein Sequence: 88 a.a.
>gi|189499529|ref|YP_001958999.1| hypothetical protein Cphamn1_0556 [Chlorobium phaeobacteroides BS1] [Cphamn1_0556]
MKYEVQIRKKVVRGLRKLPADVQKLLFLLVADLQADGPIQKSWRNFSPLGEDRYHCHLNYRYVACWTCRK
KEITIEVYYVGSREKAPY
 
Nucleotide Sequence: 267 bp
>gi|189499000|ref|NC_010831.1|:590604-590870 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0556]
ATGAAATACGAGGTTCAAATCAGGAAAAAAGTGGTTAGGGGGCTGAGGAAACTACCTGCAGATGTTCAGA
AGCTCCTTTTCTTGCTTGTTGCAGATCTCCAGGCGGATGGCCCGATTCAGAAAAGCTGGCGAAATTTTTC
GCCACTTGGTGAGGATCGCTACCACTGTCACTTGAATTATAGATACGTGGCATGCTGGACATGTCGCAAA
AAAGAAATAACGATTGAGGTGTATTATGTTGGCTCTCGTGAAAAAGCCCCGTATTGA
 Primer design

Antitoxin:
Protein Sequence: 89 a.a.
>gi|189499530|ref|YP_001959000.1| XRE family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_0557]
MILIESTSFWKEMERNRIGNLLSGARLKAGLTQTELAKRLGVRQNMISDYENGRRTYSDEMAGRLSKVLK
VKEERLKYGRKHQGTDNSE
 
Nucleotide Sequence: 270 bp
>gi|189499000|ref|NC_010831.1|:590965-591234 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0557]
ATGATTCTCATTGAAAGCACGAGCTTCTGGAAGGAAATGGAACGGAACCGCATTGGCAACCTGCTTTCCG
GTGCGCGTTTGAAGGCCGGGTTGACCCAGACTGAGCTTGCAAAGAGGCTGGGTGTTCGCCAGAACATGAT
CAGTGATTATGAAAACGGCAGACGCACCTATTCGGATGAGATGGCAGGTCGACTGAGCAAAGTGCTCAAG
GTCAAGGAAGAAAGGTTGAAATACGGAAGAAAACATCAAGGTACAGACAATTCTGAATAG
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1panC587277..588143 [-], 867189499526pantoate--beta-alanine ligase  -
2Cphamn1_0554588191..588940 [-], 750189499527uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase  -
3Cphamn1_0555589220..590446 [+], 1227189499528hypothetical protein  -
4Cphamn1_0556590604..590870 [+], 267189499529hypothetical protein  Toxin
5Cphamn1_0557590965..591234 [+], 270189499530XRE family transcriptional regulator  Antitoxin
6Cphamn1_0559591829..592851 [+], 1023189499531oligopeptide/dipeptide ABC transporter ATPase  -
7Cphamn1_0560592913..594703 [+], 1791189499532signal peptide peptidase SppA, 67K type  -
8Cphamn1_0561594810..594944 [-], 135189499533hypothetical protein  -
9Cphamn1_0562594946..595563 [+], 618189499534hypothetical protein  -
N/A