TADB
TA ID5658
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location764197..764731
Classification (toxin-antitoxin)-/RHH-RelE
ToxinCphamn1_0721 (94 a.a. | 764447..764731 | GeneID: 6374386)
AntitoxinCphamn1_0720 (89 a.a. | 764197..764466 | GeneID: 6374385)
Toxin:
Protein Sequence: 94 a.a.
>gi|189499688|ref|YP_001959158.1| RelE/StbE family addiction module toxin [Chlorobium phaeobacteroides BS1] [Cphamn1_0721]
MKVIWTEEARDRLKDIEAYIAQENPTAAKKLVRGIILKVAEQLTLYPSSGKTGRVTGTRELVFSSHPYIV
VYTVTNGNVYVLTVFHGAQKQPLV
 
Nucleotide Sequence: 285 bp
>gi|189499000|ref|NC_010831.1|:764447-764731 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0721]
GTGAAGGTGATCTGGACTGAGGAGGCCAGAGATCGGCTCAAAGACATTGAGGCTTATATCGCGCAGGAAA
ACCCGACAGCGGCCAAAAAACTGGTTCGAGGGATTATTCTCAAAGTCGCAGAGCAGCTAACATTATATCC
ATCAAGCGGTAAAACAGGACGGGTGACCGGTACTCGAGAGTTGGTTTTCTCCAGCCACCCTTATATTGTC
GTGTATACTGTTACGAATGGTAACGTTTATGTCTTGACTGTTTTTCATGGAGCGCAGAAACAGCCTCTTG
TATAG
 Primer design

Antitoxin:
Protein Sequence: 89 a.a.
>gi|189499687|ref|YP_001959157.1| CopG family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_0720]
MLTSQQKESRDQLSLRIESSTKKRIEALAQATRRSKSFVIEEAINQYLELNEWQIESIQRGIEDVKAGRV
ISHEDMLKEWEGDSEGDLD
 
Nucleotide Sequence: 270 bp
>gi|189499000|ref|NC_010831.1|:764197-764466 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0720]
ATGCTGACTTCACAGCAAAAAGAGTCTCGGGATCAATTAAGTCTGAGAATAGAGTCAAGCACGAAGAAAC
GCATCGAAGCACTGGCGCAAGCCACGAGGCGGTCGAAATCATTTGTCATCGAAGAGGCCATCAATCAGTA
CCTTGAGCTCAATGAATGGCAGATTGAGAGCATACAGAGGGGGATTGAAGATGTGAAGGCAGGACGGGTG
ATATCTCATGAGGATATGCTCAAGGAGTGGGAGGGCGACAGTGAAGGTGATCTGGACTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_0717759880..762264 [+], 2385189499684type III restriction protein res subunit  -
2Cphamn1_0718762443..763636 [+], 1194189499685hypothetical protein  -
3Cphamn1_0719764007..764135 [-], 129189499686hypothetical protein  -
4Cphamn1_0720764197..764466 [+], 270189499687CopG family transcriptional regulator  Antitoxin
5Cphamn1_0721764447..764731 [+], 285189499688RelE/StbE family addiction module toxin  Toxin
6Cphamn1_0722764750..766246 [-], 1497189499689transposase, IS5 family  -
7Cphamn1_0723766493..766840 [-], 348189499690XRE family transcriptional regulator  -
8Cphamn1_0724766837..767160 [-], 324189499691hypothetical protein  -
N/A