TADB
TA ID5662
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location784311..785356
Classification (toxin-antitoxin)-/Xre-Fic
ToxinCphamn1_0743 (198 a.a. | 784760..785356 | GeneID: 6374408)
AntitoxinCphamn1_0742 (152 a.a. | 784311..784769 | GeneID: 6374407)
Toxin:
Protein Sequence: 198 a.a.
>gi|189499707|ref|YP_001959177.1| mobile mystery protein B [Chlorobium phaeobacteroides BS1] [Cphamn1_0743]
MGLELEYLPGQTPIEEDDKQGLLVPTISTRGELDEFEQLNIEQAVQWTLSRRFRQEDILTERFVRDVHKR
MFGNVWAWAGEFRKTDTNIGVDKWQIGVELRSLLDDTGYWITNDVYSPDDIALRFKHRIVSIHCFPNGNG
RHSRLMVDIIIEQVFKRKHFSWGSDDLCAQGNTRDRYLQAVKAADRGDYTLLSEFARS
 
Nucleotide Sequence: 597 bp
>gi|189499000|ref|NC_010831.1|:784760-785356 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0743]
ATGGGATTAGAGCTCGAGTATCTGCCGGGCCAGACGCCCATTGAAGAAGACGACAAACAGGGCCTGCTTG
TTCCGACGATCAGTACACGTGGAGAACTGGATGAGTTCGAGCAGTTAAATATCGAACAGGCAGTTCAATG
GACGCTGTCGCGCAGGTTTCGACAGGAGGATATCCTGACTGAACGGTTTGTCAGGGACGTCCATAAACGG
ATGTTCGGTAATGTCTGGGCATGGGCTGGAGAATTCAGGAAAACCGATACCAATATCGGGGTAGACAAAT
GGCAGATCGGGGTGGAACTGAGAAGCCTGCTGGATGATACCGGTTACTGGATAACGAATGACGTGTATTC
TCCGGATGACATCGCTTTGCGTTTCAAGCACCGGATTGTCAGCATTCACTGTTTTCCGAACGGAAACGGG
CGGCATAGCCGGTTAATGGTGGACATTATCATCGAGCAGGTGTTCAAACGTAAACATTTCTCCTGGGGTT
CCGATGATCTTTGTGCTCAAGGAAATACGAGGGATCGGTACCTGCAGGCGGTTAAGGCAGCCGACCGCGG
AGATTATACCCTCCTGTCTGAGTTTGCACGATCCTGA
 Primer design

Antitoxin:
Protein Sequence: 152 a.a.
>gi|189499706|ref|YP_001959176.1| XRE family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_0742]
MKSRILQIDHMSQKMKVLCPAGSIATPPTGWVKAVRTALGMSMEQLGKRLGVTKQSIHDVEQREKEGSVT
IRSLSEIANALDMKLVYGFIPKDGTLDALIDRKARELAEKIVLRTAQNMRLEAQENSAERIEKAIMERKA
EIKRTMPRMLWD
 
Nucleotide Sequence: 459 bp
>gi|189499000|ref|NC_010831.1|:784311-784769 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0742]
ATGAAGAGCAGGATTTTACAGATAGACCACATGAGTCAGAAAATGAAGGTTTTGTGCCCAGCCGGCTCTA
TTGCAACACCACCTACCGGATGGGTAAAGGCGGTCAGGACAGCTCTCGGGATGTCGATGGAACAGTTGGG
CAAGCGGCTTGGTGTTACAAAGCAGAGCATCCATGATGTGGAACAGCGGGAAAAAGAGGGTTCCGTCACG
ATCAGATCGTTGAGTGAAATCGCGAACGCTCTCGATATGAAGCTTGTTTACGGTTTTATTCCCAAGGACG
GAACCCTCGATGCATTGATTGACAGAAAAGCGCGTGAGCTGGCCGAGAAAATTGTACTGCGCACGGCTCA
GAATATGAGGTTGGAAGCACAGGAAAATTCGGCAGAACGCATTGAAAAAGCGATCATGGAGCGGAAGGCG
GAAATAAAGCGGACAATGCCGAGAATGCTATGGGATTAG
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_0738780580..781248 [-], 669189499703lipoprotein  -
2Cphamn1_0740783429..783611 [+], 183189499704hypothetical protein  -
3Cphamn1_0741783820..784113 [+], 294189499705hypothetical protein  -
4Cphamn1_0742784311..784769 [+], 459189499706XRE family transcriptional regulator  Antitoxin
5Cphamn1_0743784760..785356 [+], 597189499707mobile mystery protein B  Toxin
6Cphamn1_0744785683..788481 [+], 2799189499708DNA helicase  -
N/A