TADB
TA ID5665
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location939232..939862
Classification (toxin-antitoxin)-/HEPN-MNT
ToxinCphamn1_0871 (99 a.a. | 939232..939531 | GeneID: 6374538)
AntitoxinCphamn1_0872 (114 a.a. | 939518..939862 | GeneID: 6374539)
Toxin:
Protein Sequence: 99 a.a.
>gi|189499833|ref|YP_001959303.1| DNA polymerase beta domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_0871]
MSIKVDISRDMIAEFCRRNHIRRLALFGSVLRDDFTADSDIDVLVEFEPDHVPGLAFYGMQRQLAEIFGR
KVDMNTAKDLSPYFREEVLDEAEYLYVAA
 
Nucleotide Sequence: 300 bp
>gi|189499000|ref|NC_010831.1|:939232-939531 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0871]
ATGAGTATAAAGGTTGACATTTCAAGAGATATGATTGCCGAGTTCTGCCGCCGAAATCATATCCGGCGTT
TGGCGCTTTTCGGGTCAGTGCTGAGGGATGATTTTACTGCCGATAGCGATATTGACGTTCTCGTGGAATT
CGAGCCCGACCACGTTCCGGGGCTTGCATTTTATGGCATGCAGCGGCAGTTAGCCGAAATTTTCGGCAGA
AAGGTGGATATGAATACCGCAAAAGATTTGAGTCCCTATTTTCGGGAAGAAGTTCTGGACGAGGCGGAGT
ATCTCTATGTCGCGGCGTGA
 Primer design

Antitoxin:
Protein Sequence: 114 a.a.
>gi|189499834|ref|YP_001959304.1| hypothetical protein Cphamn1_0872 [Chlorobium phaeobacteroides BS1] [Cphamn1_0872]
MSRRDPLIRVHHMLGNAREAVNMVRGRSRNDLETDRMLNLALVRLMEVIGEAAARVPADFQAGYNQVPWR
DIADLRNRLIHGYDAINFDILWTIIQDDLPPLIRHLEAIVSEKT
 
Nucleotide Sequence: 345 bp
>gi|189499000|ref|NC_010831.1|:939518-939862 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0872]
ATGTCGCGGCGTGATCCATTGATCCGGGTACATCATATGCTCGGCAATGCACGTGAAGCTGTTAATATGG
TCAGAGGGCGCTCCCGCAATGATCTGGAAACAGATAGAATGCTGAATCTCGCTCTTGTCAGGCTGATGGA
GGTTATTGGAGAGGCTGCGGCGAGGGTTCCCGCAGATTTTCAAGCCGGTTACAATCAGGTTCCCTGGCGT
GATATAGCAGATTTGCGCAACAGGTTAATTCATGGTTATGATGCTATCAACTTCGATATTCTCTGGACAA
TTATTCAGGATGACCTGCCTCCTTTAATCAGGCATCTCGAGGCAATTGTTTCCGAGAAGACATAG
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_0866935901..936149 [+], 249189499828hypothetical protein  -
2Cphamn1_0867936192..936755 [+], 564189499829hypothetical protein  -
3Cphamn1_0868936830..937258 [+], 429189499830cupin  -
4Cphamn1_0869937914..938234 [+], 321189499831hypothetical protein  -
5Cphamn1_0870938234..938560 [+], 327189499832XRE family transcriptional regulator  -
6Cphamn1_0871939232..939531 [+], 300189499833DNA polymerase beta domain-containing protein  Toxin
7Cphamn1_0872939518..939862 [+], 345189499834hypothetical protein  Antitoxin
8Cphamn1_0873940326..941207 [+], 882189499835hypothetical protein  -
9Cphamn1_0874941209..942150 [+], 942189499836D12 class N6 adenine-specific DNA methyltransferase  -
10Cphamn1_0875942080..942559 [-], 480189499837hypothetical protein  -
11Cphamn1_0878943215..943505 [+], 291189499838transposase IS3/IS911 family protein  -
12Cphamn1_0879943529..944368 [+], 840189499839integrase catalytic subunit  -
N/A