TADB
TA ID5666
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location961144..962105
Classification (toxin-antitoxin)-/Xre-RelE
ToxinCphamn1_0888 (118 a.a. | 961144..961500 | GeneID: 6374555)
AntitoxinCphamn1_0889 (190 a.a. | 961533..962105 | GeneID: 6374556)
Toxin:
Protein Sequence: 118 a.a.
>gi|189499844|ref|YP_001959314.1| hypothetical protein Cphamn1_0888 [Chlorobium phaeobacteroides BS1] [Cphamn1_0888]
MQEGWGINLDYASNSRFKRIQRNHKREFVSCFNNLNKIKVLLEKGAKLSELNYHPAFFRSEGKGLFRIGE
SGVKSAKALRLYVYPETKTKTIYILGIGTKETQQEDIAAAKDVVKNIG
 
Nucleotide Sequence: 357 bp
>gi|189499000|ref|NC_010831.1|:961144-961500 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0888]
ATGCAAGAGGGATGGGGTATAAATCTTGATTATGCAAGTAATTCGAGATTCAAGCGCATACAGAGAAACC
ATAAGAGGGAATTCGTATCCTGTTTCAATAACCTTAATAAAATTAAAGTCTTATTGGAGAAGGGGGCTAA
GCTTTCTGAGTTGAATTATCACCCTGCCTTTTTCCGCTCCGAAGGTAAGGGGTTGTTCAGGATAGGTGAA
AGCGGTGTGAAATCTGCAAAAGCGCTGAGATTGTATGTGTATCCCGAGACAAAAACAAAAACGATATACA
TTCTTGGAATCGGGACGAAGGAAACGCAACAGGAGGATATAGCTGCTGCAAAAGATGTTGTCAAAAACAT
TGGTTGA
 Primer design

Antitoxin:
Protein Sequence: 190 a.a.
>gi|189499845|ref|YP_001959315.1| XRE family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_0889]
MDKEKRLTSVSDAAAFLAGEEEVKKQVETEIENSQIVSNMLQMRVCKGVTQKELARRMGCDPSKISRMEA
GNDLQLKMGDVIQYLSVLDVSISLLFEDTSLPAAGQIKQHVYAIQEQLEKLVKIARQVDGDEEIITKIHA
FCGEVLFGFLKKFGDSYDQLCQVSGRMTRMTPLLKGQKSGAVDCEKSLYC
 
Nucleotide Sequence: 573 bp
>gi|189499000|ref|NC_010831.1|:961533-962105 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0889]
ATGGACAAGGAGAAACGACTCACATCGGTCAGTGATGCGGCAGCATTTCTTGCCGGGGAAGAAGAGGTGA
AAAAACAGGTTGAGACGGAAATAGAGAACAGTCAGATTGTCAGTAACATGCTGCAGATGAGGGTATGCAA
AGGTGTGACGCAGAAGGAACTGGCACGTCGAATGGGGTGTGATCCGAGCAAAATATCCAGGATGGAGGCA
GGTAACGACTTGCAGCTTAAAATGGGGGACGTCATACAGTATCTGTCAGTTTTGGATGTGTCCATCTCTT
TGCTTTTCGAAGATACATCACTGCCTGCCGCGGGACAGATCAAGCAACATGTGTATGCTATTCAGGAGCA
ACTTGAAAAGCTTGTGAAAATTGCCCGCCAGGTTGACGGCGACGAGGAGATTATCACTAAGATCCATGCG
TTCTGTGGGGAAGTATTGTTCGGTTTCCTGAAGAAATTCGGGGACAGCTATGATCAGCTTTGCCAGGTAT
CCGGTCGTATGACTCGTATGACGCCGTTGTTGAAAGGACAAAAAAGTGGCGCAGTTGATTGTGAAAAATC
ACTGTACTGCTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_0888961144..961500 [+], 357189499844hypothetical protein  Toxin
2Cphamn1_0889961533..962105 [+], 573189499845XRE family transcriptional regulator  Antitoxin
3Cphamn1_0890962239..963906 [-], 1668189499846filamentation induced by cAMP protein fic  -
4Cphamn1_0891964757..965047 [-], 291189499847AbrB family transcriptional regulator  -
5Cphamn1_0892965298..965492 [+], 195189499848hypothetical protein  -
N/A