TADB
TA ID5667
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location962239..965047
Classification (toxin-antitoxin)-/AbrB-Fic
ToxinCphamn1_0890 (555 a.a. | 962239..963906 | GeneID: 6374557)
AntitoxinCphamn1_0891 (96 a.a. | 964757..965047 | GeneID: 6374558)
Toxin:
Protein Sequence: 555 a.a.
>gi|189499846|ref|YP_001959316.1| filamentation induced by cAMP protein fic [Chlorobium phaeobacteroides BS1] [Cphamn1_0890]
MGLSVMLHLLRYRELVVVHYSGVPCALHLQHAQQSLNVGSTIMPDKIPTIAEACITIDSHRSWIGYAALQ
HALGCEAPLRERCAVSSGHVHGSVRLDKGIRLYDQRYRPNNDVAGHLFFSLKHETLDLLVLKEILVCLGG
ETITEIVQTYRQKQLARKLWFLYEWLTAERLPLDDAETRIRYVPILDSTHYFTGSNRPSARHRIIDNLPG
NRSFCPLIHKTAVLQKFIALDLSDKVRKVMGRASRDVWRRAASFLLLADSRASFAIEGERPPRNRIERWA
QVIQKSGNRPLSMTEILNMHGALIQDHRFVTAGFRTEGVFLGERDRNGEPQPEFIGARPQDIESLVKGLV
DSHRIMAEASIDPVIHAAAIAFGLVFIHPFEDGNGRMHRALIHQILTERSFAPPGIVFPVSAVILERIEE
YQRILREYSSPLMHSIQWQPTEKGNIEVLNDTADLYRYGNYTAIAEFLYHAVEQTISELLPKEVHYLTCY
DKARKAIGNRIDMPANQIRNLIMFITQNDMKLPLRRRQKEFAALSDEEVLAIESDVAQAFSVQEK
 
Nucleotide Sequence: 1668 bp
>gi|189499000|ref|NC_010831.1|:c963906-962239 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0890]
ATGGGATTGTCGGTCATGCTGCATCTGCTTCGTTACAGGGAACTTGTGGTAGTACACTACAGCGGCGTCC
CCTGTGCCTTGCATCTACAGCATGCTCAACAATCGCTCAACGTAGGTTCGACAATTATGCCTGACAAGAT
CCCAACCATTGCAGAAGCCTGTATCACTATCGATTCACATCGGTCATGGATCGGGTATGCTGCGTTGCAA
CATGCGCTGGGATGTGAGGCTCCACTGAGAGAACGCTGTGCTGTTTCCTCCGGCCATGTCCACGGGAGCG
TCCGGCTTGACAAAGGCATTCGCCTCTACGATCAGCGCTACCGTCCCAATAATGACGTTGCCGGGCATCT
CTTTTTCTCGCTCAAACATGAGACTCTCGATCTGCTTGTCCTGAAAGAGATTCTTGTTTGTCTCGGCGGT
GAAACCATTACCGAAATTGTCCAAACGTATCGACAGAAACAATTGGCACGAAAGCTGTGGTTTCTCTATG
AATGGTTGACTGCAGAAAGACTTCCCCTCGATGATGCAGAAACGCGAATACGTTACGTACCGATCCTCGA
TTCAACGCATTATTTCACAGGTTCAAACAGGCCATCGGCCCGGCACCGGATTATTGACAACCTGCCGGGC
AACCGTTCATTCTGTCCTCTGATACACAAAACAGCGGTTCTACAAAAATTCATCGCTCTGGACCTCTCAG
ACAAGGTCAGAAAGGTCATGGGAAGAGCAAGTCGTGACGTCTGGAGACGGGCAGCAAGTTTCTTACTGCT
TGCCGACAGCCGTGCATCGTTTGCCATCGAGGGTGAACGCCCGCCCAGAAACCGAATCGAGCGATGGGCA
CAGGTTATTCAAAAATCGGGAAACCGTCCGCTTTCGATGACTGAAATCCTGAACATGCATGGGGCACTCA
TCCAGGATCACCGTTTCGTCACTGCAGGATTTCGAACTGAAGGCGTATTCCTTGGCGAACGGGACCGTAA
CGGAGAACCGCAGCCCGAATTCATCGGTGCCCGCCCACAGGATATAGAATCCCTCGTGAAAGGACTGGTG
GACAGTCATCGCATCATGGCGGAAGCTTCGATTGACCCGGTCATCCACGCCGCTGCCATAGCGTTCGGCC
TTGTCTTCATCCATCCATTCGAAGACGGCAACGGCCGCATGCACCGTGCACTGATCCATCAGATTCTCAC
CGAACGAAGCTTTGCCCCGCCCGGAATAGTATTTCCGGTCAGCGCGGTTATACTTGAACGCATAGAGGAA
TATCAGCGCATCCTCCGCGAATATAGTTCGCCCCTCATGCACAGCATTCAATGGCAACCGACAGAAAAGG
GAAATATCGAAGTGCTCAACGACACAGCTGATCTCTACCGCTACGGGAATTACACGGCTATCGCTGAATT
CCTCTATCACGCTGTCGAACAAACTATCTCTGAACTTCTCCCAAAAGAAGTTCACTACCTGACATGTTAT
GATAAAGCCCGGAAAGCAATCGGAAACCGTATTGATATGCCCGCCAACCAGATACGCAACCTGATCATGT
TCATCACCCAAAACGATATGAAACTTCCCTTGAGAAGACGCCAGAAGGAATTTGCCGCTTTGAGCGATGA
GGAAGTGTTGGCAATTGAATCAGATGTCGCTCAGGCTTTTTCAGTGCAAGAGAAATAA
 Primer design

Antitoxin:
Protein Sequence: 96 a.a.
>gi|189499847|ref|YP_001959317.1| AbrB family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_0891]
MAKVRVRQKNQITIPLRIAEEANIKPDDMLEIRYTNGVIALMPHGRKERKRSVMDYAGIARGTWGKTIAE
IEEELKRDSNPLRLYIFHHQRSGNPI
 
Nucleotide Sequence: 291 bp
>gi|189499000|ref|NC_010831.1|:c965047-964757 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_0891]
ATGGCAAAAGTAAGAGTCCGTCAGAAAAATCAGATCACCATCCCGCTTCGTATCGCAGAAGAAGCTAATA
TCAAGCCGGACGATATGCTTGAAATACGCTATACCAACGGAGTGATTGCATTGATGCCGCATGGAAGAAA
AGAGAGAAAAAGATCGGTGATGGATTATGCCGGGATCGCAAGAGGGACCTGGGGAAAAACGATTGCAGAA
ATCGAAGAGGAACTGAAACGCGACAGCAATCCGCTCAGGCTGTACATTTTTCATCACCAACGATCTGGCA
ATCCAATCTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_0888961144..961500 [+], 357189499844hypothetical protein  -
2Cphamn1_0889961533..962105 [+], 573189499845XRE family transcriptional regulator  -
3Cphamn1_0890962239..963906 [-], 1668189499846filamentation induced by cAMP protein fic  Toxin
4Cphamn1_0891964757..965047 [-], 291189499847AbrB family transcriptional regulator  Antitoxin
5Cphamn1_0892965298..965492 [+], 195189499848hypothetical protein  -
6Cphamn1_0893965604..967649 [+], 2046189499849radical SAM protein  -
7Cphamn1_0894967723..968808 [-], 1086189499850gamma-glutamyl kinase  -
N/A