TADB
TA ID5671
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location1250190..1250748
Classification (toxin-antitoxin)-/RHH-RelE
ToxinCphamn1_1161 (104 a.a. | 1250434..1250748 | GeneID: 6374836)
AntitoxinCphamn1_1160 (83 a.a. | 1250190..1250441 | GeneID: 6374835)
Toxin:
Protein Sequence: 104 a.a.
>gi|189500108|ref|YP_001959578.1| plasmid stabilization system [Chlorobium phaeobacteroides BS1] [Cphamn1_1161]
MVSYRLTNKAVEDLAGIWSYTVDTWSENQADQYFQMLLDSFQDIATGRVIGKHYDGILQSLQGKKAGKHI
IFYRKVDSDVVEIVRILHEQMDLKNRIRGNTGNS
 
Nucleotide Sequence: 315 bp
>gi|189499000|ref|NC_010831.1|:1250434-1250748 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1161]
ATGGTTAGTTATCGTTTAACCAATAAGGCCGTGGAGGATTTGGCTGGTATATGGAGCTATACTGTTGACA
CCTGGTCAGAAAATCAAGCCGACCAATACTTCCAAATGCTACTTGACAGCTTTCAAGATATTGCAACCGG
CAGAGTGATTGGTAAGCATTATGACGGCATACTCCAAAGTCTGCAAGGGAAAAAGGCTGGTAAGCATATC
ATTTTTTACCGTAAGGTCGATAGCGATGTTGTTGAGATAGTCAGGATCCTGCATGAGCAGATGGATCTGA
AAAACAGAATCAGGGGGAATACGGGTAATTCGTAA
 Primer design

Antitoxin:
Protein Sequence: 83 a.a.
>gi|189500107|ref|YP_001959577.1| CopG/Arc/MetJ family addiction module antidote protein [Chlorobium phaeobacteroides BS1] [Cphamn1_1160]
MSKNTSITLGSHFEHFVQSSISVGRYKNASEVIRAGLRLLEEEESKVAALKQAIQEGIESGSKEDFDPEQ
FLLKLKAERSSNG
 
Nucleotide Sequence: 252 bp
>gi|189499000|ref|NC_010831.1|:1250190-1250441 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1160]
ATGAGCAAGAATACATCAATAACGTTAGGAAGTCATTTTGAACATTTTGTTCAAAGCAGCATCTCCGTTG
GGAGGTACAAGAACGCAAGCGAGGTAATTCGAGCAGGACTAAGGTTATTAGAGGAAGAAGAAAGCAAGGT
AGCAGCTTTGAAGCAAGCCATTCAAGAAGGTATTGAAAGCGGTAGTAAAGAGGATTTTGATCCGGAACAA
TTCCTGCTGAAATTGAAAGCCGAAAGGTCTTCGAATGGTTAG
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_11581247544..1248626 [+], 1083189500105HNH endonuclease  -
2Cphamn1_11591248630..1249658 [+], 1029189500106hypothetical protein  -
3Cphamn1_11601250190..1250441 [+], 252189500107CopG/Arc/MetJ family addiction module antidote protein  Antitoxin
4Cphamn1_11611250434..1250748 [+], 315189500108plasmid stabilization system  Toxin
5Cphamn1_11631251046..1252185 [+], 1140189500109glucose sorbosone dehydrogenase  -
6Cphamn1_11651252539..1253177 [-], 639189500110hypothetical protein  -
7Cphamn1_11661253477..1254328 [-], 852189500111UspA domain-containing protein  -
N/A