TADB
TA ID5673
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location1368170..1368747
Classification (toxin-antitoxin)-/RHH-COG2929
ToxinCphamn1_1262 (92 a.a. | 1368469..1368747 | GeneID: 6374939)
AntitoxinCphamn1_1261 (100 a.a. | 1368170..1368472 | GeneID: 6374938)
Toxin:
Protein Sequence: 92 a.a.
>gi|189500205|ref|YP_001959675.1| hypothetical protein Cphamn1_1262 [Chlorobium phaeobacteroides BS1] [Cphamn1_1262]
MKTINWNPEKNRKLITERKISFKEILFSMQSRGLLDDISHPGKEQYAHQRIFVIAVDEYAYLVPYVENEQ
EIFLKTIVPSRKATRQYLGDKK
 
Nucleotide Sequence: 279 bp
>gi|189499000|ref|NC_010831.1|:c1368747-1368469 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1262]
ATGAAAACCATCAACTGGAACCCGGAGAAAAACCGTAAACTTATCACTGAAAGAAAAATTTCTTTCAAAG
AAATTCTTTTTTCGATGCAGTCAAGAGGTTTGCTTGACGACATCTCTCATCCTGGCAAAGAGCAGTATGC
ACACCAGCGAATATTTGTTATTGCTGTTGATGAATACGCTTATCTGGTTCCTTATGTTGAAAATGAGCAG
GAAATTTTTCTAAAAACGATAGTACCAAGTCGCAAAGCGACCCGACAATATCTGGGAGATAAAAAATGA
 Primer design

Antitoxin:
Protein Sequence: 100 a.a.
>gi|189500204|ref|YP_001959674.1| hypothetical protein Cphamn1_1261 [Chlorobium phaeobacteroides BS1] [Cphamn1_1261]
MTTNKLDKEEQEMLKAYEAGEFTSTITPERKQFLEESAKQALKRDKKISIRISGRDLTAIQVKALQEGIP
YQTLAASIIHKYVSGDLYDESANRNVNPEN
 
Nucleotide Sequence: 303 bp
>gi|189499000|ref|NC_010831.1|:c1368472-1368170 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1261]
ATGACTACAAATAAACTCGATAAAGAAGAGCAGGAAATGCTGAAAGCTTATGAGGCGGGAGAATTCACGT
CCACTATCACCCCCGAAAGAAAGCAATTCCTTGAGGAATCAGCAAAACAGGCGCTGAAGAGAGATAAAAA
AATAAGCATCCGGATATCAGGCAGGGATCTGACAGCAATTCAAGTGAAAGCATTGCAGGAAGGGATACCG
TATCAAACCTTGGCGGCAAGCATAATTCACAAATACGTTTCCGGTGACCTGTATGACGAATCGGCAAACA
GAAACGTCAATCCTGAAAACTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_12581364863..1366269 [-], 1407189500201transposase IS4 family protein  -
2Cphamn1_12591367018..1367230 [+], 213189500202hypothetical protein  -
3Cphamn1_12601367211..1367507 [+], 297189500203hypothetical protein  -
4Cphamn1_12611368170..1368472 [-], 303189500204hypothetical protein  Antitoxin
5Cphamn1_12621368469..1368747 [-], 279189500205hypothetical protein  Toxin
6Cphamn1_12631369716..1373324 [+], 3609189500206FAD linked oxidase domain-containing protein  -
7Cphamn1_12641373392..1373496 [+], 105189500207hypothetical protein  -
N/A