TADB
TA ID5676
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location1802120..1802727
Classification (toxin-antitoxin)-/PHD-RelE
ToxinCphamn1_1668 (110 a.a. | 1802120..1802452 | GeneID: 6375354)
AntitoxinCphamn1_1669 (92 a.a. | 1802449..1802727 | GeneID: 6375355)
Toxin:
Protein Sequence: 110 a.a.
>gi|189500598|ref|YP_001960068.1| plasmid stabilization system [Chlorobium phaeobacteroides BS1] [Cphamn1_1668]
MSLSYDIFWAASAEQDLTEIIDFIATESPESALRIVRGIRERASELKSFPERGRIVPELQSQGIFLYREL
LVPPWRIAYRIKDAQVTVLSILDSRRNVEDILLERFIKRG
 
Nucleotide Sequence: 333 bp
>gi|189499000|ref|NC_010831.1|:c1802452-1802120 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1668]
ATGAGTTTGTCATATGATATTTTCTGGGCGGCCTCTGCTGAGCAGGACCTGACAGAAATCATTGACTTCA
TTGCGACGGAGAGCCCGGAAAGTGCCTTGAGGATAGTAAGGGGAATTCGCGAAAGGGCCTCTGAATTGAA
AAGCTTTCCGGAACGGGGGCGAATTGTTCCTGAATTACAATCCCAGGGAATCTTTCTGTACAGGGAGTTG
CTTGTCCCCCCATGGAGAATCGCCTATCGGATCAAAGATGCGCAGGTCACTGTTCTTTCGATTCTCGATA
GTAGGCGGAATGTTGAGGATATTCTTCTTGAGCGTTTTATAAAGAGAGGTTAG
 Primer design

Antitoxin:
Protein Sequence: 92 a.a.
>gi|189500599|ref|YP_001960069.1| prevent-host-death family protein [Chlorobium phaeobacteroides BS1] [Cphamn1_1669]
MHITNDIKPITYLKAKAADLLDQINETHRPVIITQNGEPRAVLQDPKSYEDMRNALGLLKMLAIGEEDIR
KGNLRSQEEVFNDLESRLKKQS
 
Nucleotide Sequence: 279 bp
>gi|189499000|ref|NC_010831.1|:c1802727-1802449 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1669]
ATGCATATAACGAACGACATAAAGCCGATTACTTATCTCAAGGCAAAAGCGGCAGATTTGCTGGACCAGA
TCAATGAGACGCACAGGCCGGTCATTATCACGCAGAATGGCGAACCGAGGGCGGTTCTGCAGGATCCGAA
AAGCTACGAAGATATGCGCAATGCTTTAGGATTATTGAAAATGCTTGCAATCGGTGAAGAGGACATCCGT
AAAGGAAATCTCAGGTCACAAGAGGAGGTTTTCAACGATCTCGAAAGCCGCCTGAAAAAGCAGTCATGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_16661797309..1801007 [-], 3699189500596von Willebrand factor type A  -
2Cphamn1_16671801729..1801914 [+], 186189500597hypothetical protein  -
3Cphamn1_16681802120..1802452 [-], 333189500598plasmid stabilization system  Toxin
4Cphamn1_16691802449..1802727 [-], 279189500599prevent-host-death family protein  Antitoxin
5Cphamn1_16701803294..1804241 [-], 948189500600ADP-ribosylation/Crystallin J1  -
6Cphamn1_16711804231..1807431 [-], 3201189500601helicase domain-containing protein  -
N/A