TADB
TA ID5678
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2100444..2100892
Classification (toxin-antitoxin)-/HicB-HicA
ToxinCphamn1_1936 (74 a.a. | 2100444..2100668 | GeneID: 6375628)
AntitoxinCphamn1_1937 (74 a.a. | 2100668..2100892 | GeneID: 6375629)
Toxin:
Protein Sequence: 74 a.a.
>gi|189500860|ref|YP_001960330.1| hypothetical protein Cphamn1_1936 [Chlorobium phaeobacteroides BS1] [Cphamn1_1936]
MGRLANHTYRQVVKKLKKLGFEFYRQAAGSHELWYHPERQIFTTIPNHPGDIPEGTLRAIVKQAQVTVDD
FLKA
 
Nucleotide Sequence: 225 bp
>gi|189499000|ref|NC_010831.1|:c2100668-2100444 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1936]
ATGGGAAGACTTGCCAATCATACATACAGGCAAGTTGTCAAAAAGCTGAAAAAGCTTGGATTTGAATTCT
ACAGACAGGCTGCTGGAAGCCATGAATTATGGTATCATCCCGAGAGACAAATCTTTACAACAATTCCAAA
TCATCCTGGAGATATTCCTGAAGGAACATTAAGGGCTATTGTCAAACAGGCCCAGGTAACGGTTGATGAC
TTTCTCAAAGCATAG
 Primer design

Antitoxin:
Protein Sequence: 74 a.a.
>gi|189500861|ref|YP_001960331.1| hypothetical protein Cphamn1_1937 [Chlorobium phaeobacteroides BS1] [Cphamn1_1937]
METIINIHIEKLPEGVYLATSEDIQGLVAQGRTISETLEIARDVAKKLIEAGQKNDNKEVHVQDSFDYPL
VVGM
 
Nucleotide Sequence: 225 bp
>gi|189499000|ref|NC_010831.1|:c2100892-2100668 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1937]
ATGGAAACCATCATAAACATTCATATAGAAAAGTTGCCGGAAGGTGTCTATTTGGCTACTTCTGAGGATA
TTCAGGGGCTTGTAGCTCAGGGTCGCACTATCAGCGAAACCCTGGAGATAGCTCGTGATGTCGCTAAAAA
GCTCATTGAGGCCGGACAGAAAAACGATAATAAAGAAGTCCACGTACAAGACTCTTTTGATTATCCTTTG
GTTGTAGGTATGTAA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_19302095848..2097017 [-], 1170189500855DegT/DnrJ/EryC1/StrS aminotransferase  -
2Cphamn1_19312097014..2097949 [-], 936189500856NAD-dependent epimerase/dehydratase  -
3Cphamn1_19322097993..2099054 [-], 1062189500857GDP-mannose 4,6-dehydratase  -
4Cphamn1_19332099114..2099521 [-], 408189500858polysaccharide biosynthesis protein  -
5Cphamn1_19342099724..2099981 [-], 258189500859S23 ribosomal protein  -
6Cphamn1_19362100444..2100668 [-], 225189500860hypothetical protein  Toxin
7Cphamn1_19372100668..2100892 [-], 225189500861hypothetical protein  Antitoxin
8Cphamn1_19382100972..2101139 [-], 168189500862hypothetical protein  -
9Cphamn1_19392101316..2101624 [-], 309189500863hypothetical protein  -
10Cphamn1_19402102085..2102453 [-], 369189500864S23 ribosomal protein  -
11Cphamn1_19412102915..2103205 [-], 291189500865hypothetical protein  -
12Cphamn1_19422103202..2103420 [-], 219189500866hypothetical protein  -
13Cphamn1_19442103871..2104125 [-], 255189500867excinuclease ABC C subunit domain-containing protein  -
14Cphamn1_19452104529..2104741 [-], 213189500868hypothetical protein  -
15Cphamn1_19462104731..2104991 [-], 261189500869hypothetical protein  -
16Cphamn1_19472105200..2105535 [-], 336189500870hypothetical protein  -
17Cphamn1_19482105528..2105818 [-], 291189500871DNA polymerase beta domain-containing protein  -
N/A