TADB
TA ID5683
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2111624..2112282
Classification (toxin-antitoxin)-/RHH-PIN
ToxinCphamn1_1961 (131 a.a. | 2111624..2112019 | GeneID: 6375653)
AntitoxinCphamn1_1962 (88 a.a. | 2112016..2112282 | GeneID: 6375654)
Toxin:
Protein Sequence: 131 a.a.
>gi|189500884|ref|YP_001960354.1| PilT protein domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_1961]
MIAVLDASAAVEIVLRRAQANRFAAIVKNADMVLSPLLFISEVSNVFWKYHRITGYSITESENNIEQALA
LPDNYVSESELYREAFRLGCKHDHPIYDAVYLVLARRNSAQLLTLDKRLEALAKKIGIDLA
 
Nucleotide Sequence: 396 bp
>gi|189499000|ref|NC_010831.1|:c2112019-2111624 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1961]
GTGATAGCGGTGCTTGATGCGAGCGCAGCAGTTGAGATTGTTCTGCGCAGGGCGCAGGCGAACCGGTTTG
CTGCTATCGTTAAAAATGCAGATATGGTTCTTAGCCCTTTGTTGTTTATTTCAGAAGTATCAAATGTTTT
CTGGAAGTACCATCGAATTACAGGCTATTCAATTACTGAGTCTGAAAATAACATTGAGCAAGCGCTTGCA
TTGCCTGATAATTACGTAAGTGAAAGTGAGTTGTATCGAGAGGCGTTTCGATTGGGATGTAAGCACGATC
ATCCGATATATGACGCGGTGTATCTCGTGTTGGCGCGCAGAAATAGCGCACAGTTGTTAACTCTGGATAA
GAGGTTGGAAGCCTTGGCGAAAAAAATAGGAATCGATCTTGCTTAA
 Primer design

Antitoxin:
Protein Sequence: 88 a.a.
>gi|189500885|ref|YP_001960355.1| hypothetical protein Cphamn1_1962 [Chlorobium phaeobacteroides BS1] [Cphamn1_1962]
MNRNDEKTDTMPLLQVKDFPENMYSLLQQQAKAEHRSFSQEIVVTLAKGLNHKARRAQLLQEIEQNTDVP
EKVVVLDPVELIREDRER
 
Nucleotide Sequence: 267 bp
>gi|189499000|ref|NC_010831.1|:c2112282-2112016 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1962]
ATGAACAGAAACGATGAAAAAACTGATACAATGCCATTGCTACAAGTAAAGGACTTTCCTGAAAATATGT
ATTCCCTGTTGCAGCAGCAGGCAAAGGCTGAGCATCGCAGTTTCTCTCAAGAGATAGTAGTCACCCTTGC
AAAGGGACTAAACCATAAAGCGCGAAGGGCACAACTACTTCAGGAAATTGAGCAAAATACTGACGTTCCT
GAAAAGGTGGTTGTTCTTGATCCTGTTGAGCTTATCCGTGAGGATCGGGAACGGTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_19502106826..2107050 [-], 225189500873hypothetical protein  -
2Cphamn1_19512107253..2107477 [-], 225189500874hypothetical protein  -
3Cphamn1_19522107477..2107701 [-], 225189500875hypothetical protein  -
4Cphamn1_19532107781..2107948 [-], 168189500876hypothetical protein  -
5Cphamn1_19542108125..2108433 [-], 309189500877hypothetical protein  -
6Cphamn1_19552108698..2108988 [-], 291189500878hypothetical protein  -
7Cphamn1_19562108985..2109203 [-], 219189500879hypothetical protein  -
8Cphamn1_19572109504..2109716 [-], 213189500880hypothetical protein  -
9Cphamn1_19582110066..2110401 [-], 336189500881hypothetical protein  -
10Cphamn1_19592110394..2110684 [-], 291189500882DNA polymerase beta domain-containing protein  -
11Cphamn1_19602110853..2111221 [-], 369189500883S23 ribosomal protein  -
12Cphamn1_19612111624..2112019 [-], 396189500884PilT protein domain-containing protein  Toxin
13Cphamn1_19622112016..2112282 [-], 267189500885hypothetical protein  Antitoxin
14Cphamn1_19632112490..2112714 [-], 225189500886hypothetical protein  -
15Cphamn1_19642112961..2113386 [-], 426189500887PilT protein domain-containing protein  -
16Cphamn1_19652113383..2113622 [-], 240189500888hypothetical protein  -
17Cphamn1_19662114007..2114162 [-], 156189500889hypothetical protein  -
18Cphamn1_19682114442..2115842 [+], 1401189500890hypothetical protein  -
19Cphamn1_19692116376..2116576 [-], 201189500891hypothetical protein  -
20Cphamn1_19702116573..2116812 [-], 240189500892hypothetical protein  -
N/A