TADB
TA ID5685
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2113383..2114162
Classification (toxin-antitoxin)-/RHH-PIN
ToxinCphamn1_1966 (51 a.a. | 2114007..2114162 | GeneID: 6375658)
AntitoxinCphamn1_1965 (79 a.a. | 2113383..2113622 | GeneID: 6375657)
Toxin:
Protein Sequence: 51 a.a.
>gi|189500889|ref|YP_001960359.1| hypothetical protein Cphamn1_1966 [Chlorobium phaeobacteroides BS1] [Cphamn1_1966]
MILFLDSNVLIYILEGDANLAVKVKQTIQNIVSVHGEIALAISALTRLSNP
 
Nucleotide Sequence: 156 bp
>gi|189499000|ref|NC_010831.1|:c2114162-2114007 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1966]
ATGATTCTTTTTTTGGACAGCAATGTGCTCATATATATTCTCGAAGGCGATGCAAACCTTGCTGTAAAGG
TAAAGCAAACCATCCAGAATATTGTATCAGTACATGGCGAAATAGCCTTGGCCATTAGTGCCCTTACTCG
TCTTTCTAACCCTTAA
 Primer design

Antitoxin:
Protein Sequence: 79 a.a.
>gi|189500888|ref|YP_001960358.1| hypothetical protein Cphamn1_1965 [Chlorobium phaeobacteroides BS1] [Cphamn1_1965]
MIIRNIEEDVKIRLKVRASQHGWSIEEEVCQILRSAVSEASPKHQRLGSRIAARFADIGLLEPLPELRGQ
TIAPMDFGE
 
Nucleotide Sequence: 240 bp
>gi|189499000|ref|NC_010831.1|:c2113622-2113383 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1965]
ATGATTATTCGCAATATTGAAGAGGATGTGAAAATCCGTCTAAAGGTCCGCGCCAGCCAGCACGGCTGGA
GCATTGAGGAAGAGGTCTGCCAGATTTTGCGCAGTGCCGTCAGCGAAGCTTCGCCAAAACACCAAAGACT
CGGTTCGAGGATTGCAGCGCGTTTTGCAGACATCGGTTTGCTTGAACCACTGCCGGAACTGCGCGGCCAG
ACCATAGCACCGATGGACTTTGGTGAATGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_19552108698..2108988 [-], 291189500878hypothetical protein  -
2Cphamn1_19562108985..2109203 [-], 219189500879hypothetical protein  -
3Cphamn1_19572109504..2109716 [-], 213189500880hypothetical protein  -
4Cphamn1_19582110066..2110401 [-], 336189500881hypothetical protein  -
5Cphamn1_19592110394..2110684 [-], 291189500882DNA polymerase beta domain-containing protein  -
6Cphamn1_19602110853..2111221 [-], 369189500883S23 ribosomal protein  -
7Cphamn1_19612111624..2112019 [-], 396189500884PilT protein domain-containing protein  -
8Cphamn1_19622112016..2112282 [-], 267189500885hypothetical protein  -
9Cphamn1_19632112490..2112714 [-], 225189500886hypothetical protein  -
10Cphamn1_19642112961..2113386 [-], 426189500887PilT protein domain-containing protein  -
11Cphamn1_19652113383..2113622 [-], 240189500888hypothetical protein  Antitoxin
12Cphamn1_19662114007..2114162 [-], 156189500889hypothetical protein  Toxin
13Cphamn1_19682114442..2115842 [+], 1401189500890hypothetical protein  -
14Cphamn1_19692116376..2116576 [-], 201189500891hypothetical protein  -
15Cphamn1_19702116573..2116812 [-], 240189500892hypothetical protein  -
16Cphamn1_19712117131..2117541 [-], 411189500893hypothetical protein  -
17Cphamn1_19722117526..2117921 [-], 396189500894DNA polymerase beta domain-containing protein  -
18Cphamn1_19732118199..2118567 [-], 369189500895S23 ribosomal protein  -
N/A