TADB
TA ID5687
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2315339..2315871
Classification (toxin-antitoxin)-/RHH-RelE
ToxinCphamn1_2139 (101 a.a. | 2315339..2315644 | GeneID: 6375833)
AntitoxinCphamn1_2140 (76 a.a. | 2315641..2315871 | GeneID: 6375834)
Toxin:
Protein Sequence: 101 a.a.
>gi|189501058|ref|YP_001960528.1| plasmid stabilization system [Chlorobium phaeobacteroides BS1] [Cphamn1_2139]
MSIIVFDTDARSEFLSSVEYYEECRAGLGRRFREVVELAVNSVANNPFRYRVLHKSFRRCLIPKFPHAII
FSIEPDFILVIAVAHVKRKPGYWNDRIEKYR
 
Nucleotide Sequence: 306 bp
>gi|189499000|ref|NC_010831.1|:c2315644-2315339 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2139]
ATGAGCATCATAGTATTTGATACTGATGCTCGCTCGGAGTTTTTATCATCTGTTGAGTATTATGAAGAAT
GCCGGGCAGGACTTGGCCGTCGCTTCCGCGAGGTTGTTGAATTGGCTGTAAACTCAGTAGCAAACAATCC
TTTTCGTTACCGAGTACTCCACAAGTCTTTTCGGCGGTGTCTTATACCGAAGTTTCCTCATGCAATAATT
TTTTCTATTGAACCAGATTTCATTCTGGTCATTGCTGTGGCGCATGTCAAACGTAAGCCGGGGTACTGGA
ATGATCGTATTGAAAAATACCGGTAA
 Primer design

Antitoxin:
Protein Sequence: 76 a.a.
>gi|189501059|ref|YP_001960529.1| addiction module protein [Chlorobium phaeobacteroides BS1] [Cphamn1_2140]
MTEMAKKIVQEALRLPIEERAFLADRLLGSLDREVMTEVDAAWVAEAESRYAEYKAGKRKPVSAKDVFDE
ADRLLT
 
Nucleotide Sequence: 231 bp
>gi|189499000|ref|NC_010831.1|:c2315871-2315641 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2140]
ATGACAGAAATGGCAAAAAAAATAGTGCAGGAGGCTCTCAGGTTGCCAATCGAAGAACGTGCTTTTCTTG
CCGATAGACTTCTTGGTTCGCTGGACCGTGAGGTGATGACCGAGGTCGATGCTGCATGGGTGGCTGAAGC
AGAGAGCCGTTATGCGGAATACAAGGCAGGAAAACGGAAACCTGTTTCTGCGAAAGATGTCTTTGATGAA
GCAGATCGTCTGCTTACATGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_21342310916..2311389 [-], 474189501053FKBP-type peptidylprolyl isomerase  -
2Cphamn1_21352311622..2312305 [+], 684189501054surface antigen msp4 family protein  -
3Cphamn1_21362312377..2313426 [-], 1050189501055mechanosensitive ion channel MscS  -
4Cphamn1_21372313446..2314636 [-], 1191189501056amine oxidase  -
5Cphamn1_21382314731..2315273 [-], 543189501057transferase  -
6Cphamn1_21392315339..2315644 [-], 306189501058plasmid stabilization system  Toxin
7Cphamn1_21402315641..2315871 [-], 231189501059addiction module protein  Antitoxin
8Cphamn1_21412316278..2316475 [-], 198189501060hypothetical protein  -
9Cphamn1_21422316623..2318020 [+], 1398189501061hypothetical protein  -
10Cphamn1_21432318250..2318783 [-], 534189501062hypothetical protein  -
11Cphamn1_21442318883..2320280 [+], 1398189501063hypothetical protein  -
N/A