TADB
TA ID5688
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2347025..2347558
Classification (toxin-antitoxin)-/Xre-HipA
ToxinCphamn1_2167 (107 a.a. | 2347025..2347348 | GeneID: 6375861)
AntitoxinCphamn1_2168 (68 a.a. | 2347352..2347558 | GeneID: 6375862)
Toxin:
Protein Sequence: 107 a.a.
>gi|189501083|ref|YP_001960553.1| HipA N-terminal domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_2167]
MQKAEIQYLDRTAGWLIQDEEGYHFIYDQEYLNSRDPKPVSLTLPLRESEYTSTTMFPFFDGLIPEGWLL
DVAERNWKLDPRDRMGLLMNCCKDCIGAVSVHPVIRE
 
Nucleotide Sequence: 324 bp
>gi|189499000|ref|NC_010831.1|:c2347348-2347025 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2167]
ATGCAAAAAGCTGAGATACAGTACCTTGATCGAACTGCGGGCTGGCTGATTCAGGATGAAGAGGGGTATC
ATTTTATTTATGATCAGGAGTACCTGAATTCCAGGGATCCCAAACCGGTAAGTCTTACGCTGCCCTTGCG
GGAAAGTGAATACACAAGCACGACTATGTTTCCATTTTTTGACGGGTTGATACCCGAAGGCTGGCTACTC
GATGTTGCGGAAAGAAACTGGAAGCTTGATCCGCGAGATCGCATGGGACTTTTGATGAACTGCTGCAAGG
ATTGCATCGGGGCGGTCAGTGTGCATCCTGTCATCAGGGAGTGA
 Primer design

Antitoxin:
Protein Sequence: 68 a.a.
>gi|189501084|ref|YP_001960554.1| XRE family transcriptional regulator [Chlorobium phaeobacteroides BS1] [Cphamn1_2168]
MKDLSEFVRFKRKSLGMTQPELAEKAGTGLRFIRDLEQGKKTLRMDKVNQVLGLFGYELAPVKQEREV
 
Nucleotide Sequence: 207 bp
>gi|189499000|ref|NC_010831.1|:c2347558-2347352 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2168]
ATGAAAGATCTATCAGAATTTGTTCGTTTCAAGCGAAAGTCTTTGGGAATGACCCAGCCTGAGCTGGCAG
AAAAAGCCGGAACGGGTCTTCGTTTCATTCGTGATCTTGAACAAGGGAAGAAAACGTTACGAATGGACAA
GGTAAACCAGGTTCTTGGATTGTTTGGTTACGAGCTTGCTCCTGTGAAGCAGGAAAGGGAGGTATAG
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_21652342309..2342626 [+], 318189501081CRISPR-associated protein Cas2  -
2Cphamn1_21662346068..2347021 [-], 954189501082HipA domain-containing protein  -
3Cphamn1_21672347025..2347348 [-], 324189501083HipA N-terminal domain-containing protein  Toxin
4Cphamn1_21682347352..2347558 [-], 207189501084XRE family transcriptional regulator  Antitoxin
5Cphamn1_21692347573..2347869 [-], 297189501085hypothetical protein  -
6Cphamn1_21702348614..2349348 [+], 735189501086ABC transporter-like protein  -
7Cphamn1_21712349531..2351060 [+], 1530189501087radical SAM protein  -
8Cphamn1_21722351069..2352478 [+], 1410189501088metal dependent phosphohydrolase  -
N/A