TADB
TA ID5692
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2511144..2511814
Classification (toxin-antitoxin)-/PHD-PIN
ToxinCphamn1_2339 (141 a.a. | 2511144..2511569 | GeneID: 6376034)
AntitoxinCphamn1_2340 (82 a.a. | 2511566..2511814 | GeneID: 6376035)
Toxin:
Protein Sequence: 141 a.a.
>gi|189501251|ref|YP_001960721.1| PilT protein domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_2339]
MSFLLDTCVISELVRPVPDEGVVRWIEARNEFDLFLSVLTLGEIQKGISKLSAGKKKSKLKVWLEEELAV
RFAERVLPVTDDIALMWGSMLGRSEKNGQTLSVIDALIAATASVHNLALVTRNISDFNGCSIDIVDPWSI
S
 
Nucleotide Sequence: 426 bp
>gi|189499000|ref|NC_010831.1|:c2511569-2511144 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2339]
GTGAGTTTTCTCCTTGATACCTGTGTTATTTCCGAGCTGGTGCGTCCGGTTCCGGATGAGGGTGTAGTAC
GGTGGATCGAGGCTCGAAACGAGTTCGATCTTTTTCTGAGCGTTCTGACTCTTGGCGAAATCCAGAAAGG
CATCTCCAAACTCTCTGCCGGCAAAAAGAAGTCAAAGCTGAAGGTATGGCTCGAAGAAGAGCTGGCCGTC
CGTTTTGCGGAGAGAGTCCTTCCCGTTACCGATGATATTGCGCTGATGTGGGGCAGCATGCTCGGCAGGT
CTGAAAAAAACGGTCAGACCCTTTCGGTTATCGATGCGCTAATCGCCGCAACGGCGAGCGTGCACAACCT
GGCTCTGGTGACACGGAATATCTCCGACTTCAATGGATGCTCGATCGATATCGTCGATCCGTGGAGTATT
TCCTGA
 Primer design

Antitoxin:
Protein Sequence: 82 a.a.
>gi|189501252|ref|YP_001960722.1| prevent-host-death family protein [Chlorobium phaeobacteroides BS1] [Cphamn1_2340]
MENWQIQKAKNQFSDLVRKAQEKGPQTITRHGKAEAVLLSMKDYRNLMKKQESLTEFFRRSPLYGATLDL
ERKKEAGREVEL
 
Nucleotide Sequence: 249 bp
>gi|189499000|ref|NC_010831.1|:c2511814-2511566 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_2340]
ATGGAAAACTGGCAGATACAGAAAGCGAAAAACCAATTCAGTGATCTTGTCCGGAAAGCACAGGAAAAAG
GGCCGCAAACTATTACAAGGCACGGTAAGGCCGAAGCAGTGCTGCTTTCGATGAAGGATTACCGTAACCT
GATGAAAAAACAGGAGTCGCTAACGGAGTTTTTTCGTCGGTCACCGTTGTATGGGGCAACGCTGGATCTG
GAAAGAAAAAAAGAGGCAGGCAGGGAGGTTGAACTGTGA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_23332506358..2507332 [-], 975189501245hypothetical protein  -
2Cphamn1_23342507563..2507847 [-], 285189501246CRISPR-associated protein Cas2  -
3Cphamn1_23352507888..2508463 [+], 576189501247hypothetical protein  -
4Cphamn1_23362508585..2509559 [-], 975189501248hypothetical protein  -
5Cphamn1_23372510113..2510664 [+], 552189501249hypothetical protein  -
6Cphamn1_23382510661..2510891 [+], 231189501250hypothetical protein  -
7Cphamn1_23392511144..2511569 [-], 426189501251PilT protein domain-containing protein  Toxin
8Cphamn1_23402511566..2511814 [-], 249189501252prevent-host-death family protein  Antitoxin
9Cphamn1_23412512240..2512473 [+], 234189501253hypothetical protein  -
10Cphamn1_23422512548..2513528 [-], 981189501254hypothetical protein  -
11Cphamn1_23432513530..2514408 [-], 879189501255von Willebrand factor type A  -
12Cphamn1_23442514885..2515883 [-], 999189501256ATPase  -
13Cphamn1_23452515975..2516220 [-], 246189501257hypothetical protein  -
N/A