TADB
TA ID6193
Type2
RepliconNC_010831 [Browse all TAs(s) in this replicon]
StrainChlorobium phaeobacteroides BS1 chromosome, complete genome.
Location2110066..2110684
Classification (toxin-antitoxin)-/(antitoxin)
ToxinCphamn1_1958 (335 a.a. | 2110066..2110401 | GeneID: 6375650)
AntitoxinCphamn1_1959 (290 a.a. | 2110394..2110684 | GeneID: 6375651)
Toxin:
Protein Sequence: 335 a.a.
>gi|189500881|ref|YP_001960351.1| hypothetical protein Cphamn1_1958 [Chlorobium phaeobacteroides BS1] [Cphamn1_1958]
MSKRDWKLFLEDILESIEWIEDFIKGMDAESFACDRKTVDAVVRNFEIIGEAAKSIPVDIRERHQGVDWS
GMIGLRNRIAHEYFGLSLPIIWKIAVDDLPKLKNEIIRIEE
 
Nucleotide Sequence: 336 bp
>gi|189499000|ref|NC_010831.1|:c2110401-2110066 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1958]
ATGTCTAAGCGGGACTGGAAACTGTTTCTTGAAGATATTCTGGAGTCCATTGAGTGGATTGAGGACTTTA
TCAAGGGGATGGATGCCGAGTCATTTGCCTGCGACAGGAAAACTGTGGATGCTGTTGTTAGAAATTTTGA
GATCATTGGGGAAGCTGCTAAATCTATTCCTGTCGATATTAGAGAAAGACATCAGGGCGTTGACTGGAGT
GGCATGATTGGATTAAGAAACAGGATTGCACATGAATATTTTGGACTCAGTCTGCCTATTATCTGGAAAA
TTGCGGTAGATGATCTTCCAAAGTTAAAAAATGAAATTATTCGGATTGAAGAATAG
 Primer design

Antitoxin:
Protein Sequence: 290 a.a.
>gi|189500882|ref|YP_001960352.1| DNA polymerase beta domain-containing protein [Chlorobium phaeobacteroides BS1] [Cphamn1_1959]
MKSIDELKEIIAQNRTILEQKYKVKSLAFFGSFVRGDQTDGSDIDVMVEFSEPVGLLFIHLADYLEEILG
MKVDLLTPEAVKLNRKKHIMSELEYV
 
Nucleotide Sequence: 291 bp
>gi|189499000|ref|NC_010831.1|:c2110684-2110394 Chlorobium phaeobacteroides BS1 chromosome, complete genome [Cphamn1_1959]
ATGAAATCAATTGATGAACTCAAAGAAATAATTGCTCAAAACCGGACAATACTTGAGCAAAAATATAAAG
TCAAGTCGCTTGCTTTTTTTGGATCATTTGTTCGGGGAGATCAAACGGATGGCAGTGATATTGATGTGAT
GGTTGAGTTTAGTGAGCCGGTTGGATTGCTTTTCATTCATTTGGCAGATTATCTGGAAGAAATTCTTGGT
ATGAAAGTCGATCTTCTTACACCAGAAGCCGTAAAGCTCAACCGCAAGAAACATATTATGAGTGAGTTAG
AGTATGTCTAA
 Primer design


The information of TA components from NC_010831
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1Cphamn1_19472105200..2105535 [-], 336189500870hypothetical protein  -
2Cphamn1_19482105528..2105818 [-], 291189500871DNA polymerase beta domain-containing protein  -
3Cphamn1_19492105987..2106355 [-], 369189500872S23 ribosomal protein  -
4Cphamn1_19502106826..2107050 [-], 225189500873hypothetical protein  -
5Cphamn1_19512107253..2107477 [-], 225189500874hypothetical protein  -
6Cphamn1_19522107477..2107701 [-], 225189500875hypothetical protein  -
7Cphamn1_19532107781..2107948 [-], 168189500876hypothetical protein  -
8Cphamn1_19542108125..2108433 [-], 309189500877hypothetical protein  -
9Cphamn1_19552108698..2108988 [-], 291189500878hypothetical protein  -
10Cphamn1_19562108985..2109203 [-], 219189500879hypothetical protein  -
11Cphamn1_19572109504..2109716 [-], 213189500880hypothetical protein  -
12Cphamn1_19582110066..2110401 [-], 336189500881hypothetical protein  Toxin
13Cphamn1_19592110394..2110684 [-], 291189500882DNA polymerase beta domain-containing protein  Antitoxin
14Cphamn1_19602110853..2111221 [-], 369189500883S23 ribosomal protein  -
15Cphamn1_19612111624..2112019 [-], 396189500884PilT protein domain-containing protein  -
16Cphamn1_19622112016..2112282 [-], 267189500885hypothetical protein  -
17Cphamn1_19632112490..2112714 [-], 225189500886hypothetical protein  -
18Cphamn1_19642112961..2113386 [-], 426189500887PilT protein domain-containing protein  -
19Cphamn1_19652113383..2113622 [-], 240189500888hypothetical protein  -
20Cphamn1_19662114007..2114162 [-], 156189500889hypothetical protein  -
N/A