TADB
TA ID694
Type2
RepliconNC_004557 [Browse all TAs(s) in this replicon]
StrainClostridium tetani E88 chromosome, complete genome.
Location1527185..1527860
Classification (toxin-antitoxin)-/HEPN-MNT
ToxinCTC01415 (101 a.a. | 1527185..1527490 | GeneID: 1060171)
AntitoxinCTC01416 (133 a.a. | 1527459..1527860 | GeneID: 1059506)
Toxin:
Protein Sequence: 101 a.a.
>gi|28211092|ref|NP_782036.1| nucleotidyltransferase [Clostridium tetani E88] [CTC01415]
MLDDKLKTQLEKIFAKYPQVEKVVLFGSRARGDNKYNSDIDLCIFGEELSHLTLAKITFYIEDLDTCLMF
DILAFNELTKKDLIKNILNEGVVIYRGKEVE
 
Nucleotide Sequence: 306 bp
>gi|28209834|ref|NC_004557.1|:1527185-1527490 Clostridium tetani E88 chromosome, complete genome [CTC01415]
TTGTTAGATGACAAATTAAAAACTCAGCTAGAAAAAATCTTTGCAAAGTATCCCCAAGTTGAAAAAGTAG
TATTATTTGGCTCACGTGCTAGAGGAGATAATAAGTATAATTCGGATATAGATTTATGTATATTTGGTGA
AGAACTAAGCCATTTAACATTAGCTAAAATTACTTTTTATATAGAGGATTTAGATACATGCTTAATGTTT
GATATATTAGCATTCAACGAATTAACTAAAAAAGATTTAATAAAAAATATATTAAATGAAGGAGTTGTTA
TTTATCGTGGCAAAGAGGTTGAATGA
 Primer design

Antitoxin:
Protein Sequence: 133 a.a.
>gi|28211093|ref|NP_782037.1| nucleotidyltransferase [Clostridium tetani E88] [CTC01416]
MLFIVAKRLNERISDFANAFSRLQEAFKKDIDDDIIIDGIIQRFEFTFEQSWKVMKLYLEDQGILDEALS
PRSTIRLAFKYKIISDGDIWIQMMLDRNRTSHMYDETIAKNIVKRIKDTYMKEFTKLQDFLQR
 
Nucleotide Sequence: 402 bp
>gi|28209834|ref|NC_004557.1|:1527459-1527860 Clostridium tetani E88 chromosome, complete genome [CTC01416]
TTGTTATTTATCGTGGCAAAGAGGTTGAATGAAAGAATAAGTGATTTTGCAAATGCATTCTCTAGACTAC
AAGAAGCTTTTAAAAAAGATATTGATGATGATATAATAATAGATGGTATTATCCAAAGGTTTGAATTTAC
ATTTGAACAAAGTTGGAAGGTTATGAAGTTATATCTAGAAGATCAAGGTATATTAGATGAAGCCTTGTCT
CCTAGAAGCACTATCCGATTAGCTTTTAAATATAAAATAATTTCTGATGGAGATATATGGATTCAAATGA
TGTTAGATAGAAATAGGACATCTCATATGTATGATGAAACTATAGCTAAGAATATAGTTAAAAGAATTAA
GGATACTTATATGAAAGAATTTACAAAATTACAAGATTTTTTACAAAGGTAA
 Primer design


The information of TA components from NC_004557
#Locus tag (Gene)Coordinates [+/-], size (bp)Protein GIProductComponent (H_value)
1CTC014111523253..1524242 [-], 99028211088transcriptional regulatory protein  -
2vanZ1524369..1524926 [-], 55828211089hypothetical protein  -
3CTC014131525054..1525524 [+], 47128211090methylated-DNA--protein-cysteine methyltransferase  -
4CTC014141525542..1526228 [+], 68728211091hypothetical protein  -
5CTC014151527185..1527490 [+], 30628211092nucleotidyltransferase  Toxin
6CTC014161527459..1527860 [+], 40228211093nucleotidyltransferase  Antitoxin
7vanZ1527941..1528858 [-], 91828211094hypothetical protein  -
8CTC014181528858..1531485 [-], 262828211095permease  -
9CTC014191531482..1532165 [-], 68428211096transporter  -
N/A