TADB
TA familypasABC
ToxinpasB
AntitoxinpasA
OtherpasC
Note The pasABC locus was identified in the broad-host-range plasmid pTF-FC2. The pasB gene encodes a toxin, which is inactivated by the antidote PasA. PasC enhances toxin-antidote neutralization.
Gene symbolpasB (orf4)
NCBI RefSeqGeneID:154646
Repliconplasmid pTF-FC2
StrandForward
Position, Length302..574 [+], 273bp
SpeciesThiobacillus ferrooxidans strain FC1
Nucleotide Sequence273 bp
>pasB toxin 273bp plasmid pTF-FC2
ATGGCATGGAAGGTTGAACTCGACCCAGCCGCCGAGCGCGAGCTAGGCAAGATCGACCAGCAGACCGCCC
GCCGCATCCTCGCTTTTTTGCATGGCCGTGTCGCCCAGCTCGACGACCCGCGCAGCATTGGCGAAGCCCT
CAAAGGCTCCAAACTGGGAGCCTTCTGGAAATACCGCGTTGGGGATTGGCGAATCATCGCCAGCATCGAG
GACGGTGCTTTGCGCATCCTCGTTATGCGCATCGGCAATCGTAAGGAGGTTTACCGCCAATGA
Protein Sequence90 aa
>pasB toxin 90aa plasmid pTF-FC2
MAWKVELDPAAERELGKIDQQTARRILAFLHGRVAQLDDPRSIGEALKGSKLGAFWKYRVGDWRIIASIE
DGALRILVMRIGNRKEVYRQ*
Gene symbolpasA (orf3)
NCBI RefSeqGeneID:154646
Repliconplasmid pTF-FC2
StrandForward
Position, Length94..318 [+], 225bp
SpeciesThiobacillus ferrooxidans strain FC1
Nucleotide Sequence225 bp
>pasA antitoxin 255bp plasmid pTF-FC2
ATGCTTGCAATCCGACTGCCCGCCGAAGTGGAAACCCGCCTTGAAGCACTGGCGCAGGCCACAGGGCGGA
CCAAGACTTTCTATGCCCGCGAAGCCATCCTTGAGCACTTGGATGACCTCGAAGATTTGTACCTTGCAGA
GCAACGCCTGATCGACATTCGCGCAGGCAAAACCCAAACCGTGCCACTCGAAGAAGTGATGAAACGCTAT
GGCATGGAAGGTTGA
Protein Sequence74 aa
>pasA antitoxin 74aa plasmid pTF-FC2
MLAIRLPAEVETRLEALAQATGRTKTFYAREAILEHLDDLEDLYLAEQRLIDIRAGKTQTVPLEEVMKRY
GMEG*
Gene symbolpasC (orf5)
NCBI RefSeqGeneID:154646
Repliconplasmid pTF-FC2
StrandForward
Position, Length571..786 [+], 216bp
SpeciesThiobacillus ferrooxidans strain FC1
Nucleotide Sequence216 bp
>pasC enhancer 216bp plasmid pTF-FC2
ATGATCGAATACAGCTACCAGATCGACCCGCGCCCCTCCGACCTTGGCGGCGGCTGGCGGTTGCGCCTGT
TGGAAAGCGGCGAGGAAGTCGGCGGCGGAGTGTTCCCGTTGTCCGAGTACGCCACAGCAGAGAACGCAGA
AGAAGCGGCCACGTACGCCTATGAGGACGCCTTGGCCGAGGCTTCGGCGTGGCTGGCATCGAGGGGCGAA
AATTGA
Protein Sequence71 aa
>pasC enhancer 71aa plasmid pTF-FC2
MIEYSYQIDPRPSDLGGGWRLRLLESGEEVGGGVFPLSEYATAENAEEAATYAYEDALAEASAWLASRGE
N*
References
(1) Matcher GF et al. (2009) The effect of the location of the proteic post-segregational stability systemwithin the replicon of plasmid pTF-FC2 on the fine regulation of plasmidreplication. Plasmid 62(2):98-107. [PudMed:19481568] experimental
(2) Deane SM et al. (2004) Plasmid evolution and interaction between the plasmid addiction stabilitysystems of two related broad-host-range IncQ-like plasmids. J Bacteriol 186(7):2123-33. [PudMed:15028698] experimental
(3) Smith AS et al. (1998) Autoregulation of the pTF-FC2 proteic poison-antidote plasmid addiction system(pas) is essential for plasmid stabilization. J Bacteriol 180(20):5463-5. [PudMed:9765582] experimental
(4) Smith AS et al. (1997) The poison-antidote stability system of the broad-host-range Thiobacillusferrooxidans plasmid pTF-FC2. Mol Microbiol 26(5):961-70. [PudMed:9426133] experimental
 
experimental experimental literature